PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

NNU_003135-RA

Organism

Nelumbo nucifera

Taxonomic ID

4432

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo

Family

MIKC_MADS

Protein Properties

Length: 204aa MW: 23869.2 Da PI: 10.6893

Description

MIKC_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
NNU_003135-RA	genome	CAS	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	90.8	7.1e-29	9	58	1	50
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50 krie ++nrqvtf kRrng+lKKA+ELS+LCdaeva+iifs+tgkly ++ NNU_003135-RA 9 KRIEKTTNRQVTFFKRRNGLLKKAFELSILCDAEVALIIFSPTGKLYQFA 58 79**********************************************98 PP
2	K-box	78.3	1.9e-26	79	172	5	98
K-box 5 sgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 +++++++++a+ +++e++ L+k i++L+ +Rhl Ged++ L +keLq+Le+qL+ ++++iRs+K + + e+i+ l+ ++k+lq++n +L+++l NNU_003135-RA 79 ETNNQTSRTAQFWREEIEDLRKSIQTLEARHRHLAGEDISLLGIKELQELERQLKIGVERIRSRKRRAISESINLLKTRQKALQNDNARLQRQL 172 566789999**********************************************************************************997 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50066	32.24	1	61	IPR002100	Transcription factor, MADS-box
SMART	SM00432	1.4E-38	1	60	IPR002100	Transcription factor, MADS-box
SuperFamily	SSF55455	4.32E-32	2	77	IPR002100	Transcription factor, MADS-box
CDD	cd00265	5.92E-40	2	70	No hit	No description
PROSITE pattern	PS00350	0	3	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	8.3E-30	3	23	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	1.9E-26	10	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	8.3E-30	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	8.3E-30	38	59	IPR002100	Transcription factor, MADS-box
Pfam	PF01486	2.5E-23	84	172	IPR002487	Transcription factor, K-box
PROSITE profile	PS51297	13.224	88	178	IPR002487	Transcription factor, K-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0009553	Biological Process	embryo sac development
GO:0009911	Biological Process	positive regulation of flower development
GO:0010094	Biological Process	specification of carpel identity
GO:0010228	Biological Process	vegetative to reproductive phase transition of meristem
GO:0010582	Biological Process	floral meristem determinacy
GO:0045893	Biological Process	positive regulation of transcription, DNA-templated
GO:0048455	Biological Process	stamen formation
GO:0048459	Biological Process	floral whorl structural organization
GO:0048509	Biological Process	regulation of meristem development
GO:0048833	Biological Process	specification of floral organ number
GO:0080060	Biological Process	integument development
GO:0080112	Biological Process	seed growth
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 204 aa Download sequence Send to blast
MGRGRVELKR IEKTTNRQVT FFKRRNGLLK KAFELSILCD AEVALIIFSP TGKLYQFANP 60 DMDRILARYR YEVRMAQPET NNQTSRTAQF WREEIEDLRK SIQTLEARHR HLAGEDISLL 120 GIKELQELER QLKIGVERIR SRKRRAISES INLLKTRQKA LQNDNARLQR QLHVENSISS 180 FWEGRSNACL TFQSSRPGQD EADP

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
5f28_A	2e-24	1	69	1	69	MEF2C
5f28_B	2e-24	1	69	1	69	MEF2C
5f28_C	2e-24	1	69	1	69	MEF2C
5f28_D	2e-24	1	69	1	69	MEF2C
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor. Regulates floral organ identity and floral meristem determinacy. May be involved in the control of flowering time. {ECO:0000269\|PubMed:19820190, ECO:0000269\|Ref.8}.

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00315	DAP	Transfer from AT2G45650	Download

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_010249055.1	1e-149	PREDICTED: truncated transcription factor CAULIFLOWER D-like isoform X1
Swissprot	Q6EU39	9e-52	MADS6_ORYSJ; MADS-box transcription factor 6
TrEMBL	A0A1U7ZCU1	1e-147	A0A1U7ZCU1_NELNU; truncated transcription factor CAULIFLOWER D-like isoform X1
STRING	XP_010249055.1	1e-148	(Nelumbo nucifera)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G42830.1	3e-49	MIKC_MADS family protein

Publications ? help Back to Top
Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764] Li H, et al. The AGL6-like gene OsMADS6 regulates floral organ and meristem identities in rice. Cell Res., 2010. 20(3): p. 299-313 [PMID:20038961] Zhang J,Nallamilli BR,Mujahid H,Peng Z OsMADS6 plays an essential role in endosperm nutrient accumulation and is subject to epigenetic regulation in rice (Oryza sativa). Plant J., 2010. 64(4): p. 604-17 [PMID:20822505] Seok HY, et al. Rice ternary MADS protein complexes containing class B MADS heterodimer. Biochem. Biophys. Res. Commun., 2010. 401(4): p. 598-604 [PMID:20888318] Li H, et al. Rice MADS6 interacts with the floral homeotic genes SUPERWOMAN1, MADS3, MADS58, MADS13, and DROOPING LEAF in specifying floral organ identities and meristem fate. Plant Cell, 2011. 23(7): p. 2536-52 [PMID:21784949] Yadav SR,Khanday I,Majhi BB,Veluthambi K,Vijayraghavan U Auxin-responsive OsMGH3, a common downstream target of OsMADS1 and OsMADS6, controls rice floret fertility. Plant Cell Physiol., 2011. 52(12): p. 2123-35 [PMID:22016342] Duan Y, et al. Characterization of Osmads6-5, a null allele, reveals that OsMADS6 is a critical regulator for early flower development in rice (Oryza sativa L.). Plant Mol. Biol., 2012. 80(4-5): p. 429-42 [PMID:22933119] Conrad LJ, et al. The polycomb group gene EMF2B is essential for maintenance of floral meristem determinacy in rice. Plant J., 2014. 80(5): p. 883-94 [PMID:25279942] Zhang J, et al. Down-regulation of a LBD-like gene, OsIG1, leads to occurrence of unusual double ovules and developmental abnormalities of various floral organs and megagametophyte in rice. J. Exp. Bot., 2015. 66(1): p. 99-112 [PMID:25324400] Bai X, et al. Regulatory role of FZP in the determination of panicle branching and spikelet formation in rice. Sci Rep, 2016. 6: p. 19022 [PMID:26744119] Zhang B, et al. A High Temperature-Dependent Mitochondrial Lipase EXTRA GLUME1 Promotes Floral Phenotypic Robustness against Temperature Fluctuation in Rice (Oryza sativa L.). PLoS Genet., 2016. 12(7): p. e1006152 [PMID:27367609]