PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_006256-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family M-type_MADS
Protein Properties Length: 63aa    MW: 7118.36 Da    PI: 11.5161
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_006256-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF90.49.1e-291059251
                   ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
         SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                   ri+n++ rqvtfskRrng+lKKA EL +LCdaev +iifsstgkly+++s
  NNU_006256-RA 10 RIDNSTSRQVTFSKRRNGLLKKARELAILCDAEVGLIIFSSTGKLYDFAS 59
                   8***********************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006631.833161IPR002100Transcription factor, MADS-box
SMARTSM004323.3E-40160IPR002100Transcription factor, MADS-box
CDDcd002653.11E-37263No hitNo description
SuperFamilySSF554551.22E-28261IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004041.0E-29323IPR002100Transcription factor, MADS-box
PfamPF003191.1E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004041.0E-292338IPR002100Transcription factor, MADS-box
PRINTSPR004041.0E-293859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 63 aa     Download sequence    Send to blast
MGRGKIVIRR IDNSTSRQVT FSKRRNGLLK KARELAILCD AEVGLIIFSS TGKLYDFAST  60
RCR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5f28_A3e-20160160MEF2C
5f28_B3e-20160160MEF2C
5f28_C3e-20160160MEF2C
5f28_D3e-20160160MEF2C
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor.
UniProtProbable transcription factor involved in the regulation of flowering time in long-day photoperiod. Participates in the repression of FT expression and floral transition, by interacting closely with the FLC-SVP pathways (PubMed:24876250). Functions in the satellite meristemoid lineage of stomatal development (PubMed:17704216). {ECO:0000269|PubMed:17704216, ECO:0000269|PubMed:24876250}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Repressed by the micro RNA miR824. {ECO:0000269|PubMed:18579782}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_026433223.18e-36MADS-box transcription factor 27-like isoform X6
SwissprotA2RVQ58e-31AGL16_ARATH; Agamous-like MADS-box protein AGL16
SwissprotQ6EP498e-31MAD27_ORYSJ; MADS-box transcription factor 27
TrEMBLA0A3S3LZ251e-34A0A3S3LZ25_9MAGN; Agamous-like MADS-box protein AGL21
STRINGevm.model.supercontig_177.142e-34(Carica papaya)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G57230.13e-33AGAMOUS-like 16
Publications ? help Back to Top
  1. Puig J, et al.
    Analysis of the expression of the AGL17-like clade of MADS-box transcription factors in rice.
    Gene Expr. Patterns, 2013 Jun-Jul. 13(5-6): p. 160-70
    [PMID:23466806]
  2. Yang K,Jiang M,Le J
    A new loss-of-function allele 28y reveals a role of ARGONAUTE1 in limiting asymmetric division of stomatal lineage ground cell.
    J Integr Plant Biol, 2014. 56(6): p. 539-49
    [PMID:24386951]
  3. Yu C, et al.
    The effects of fluctuations in the nutrient supply on the expression of five members of the AGL17 clade of MADS-box genes in rice.
    PLoS ONE, 2014. 9(8): p. e105597
    [PMID:25140876]