PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

NNU_008269-RA

Organism

Nelumbo nucifera

Taxonomic ID

4432

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo

Family

M-type_MADS

Protein Properties

Length: 89aa MW: 10400.1 Da PI: 10.9404

Description

M-type_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
NNU_008269-RA	genome	CAS	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	102.8	1.2e-32	9	59	1	51
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krienk+nrqvtf+kRrng+lKKA+ELSvLCdaeva+iifs++gklye++s NNU_008269-RA 9 KRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCS 59 79***********************************************96 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00432	1.3E-41	1	60	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS50066	33.515	1	61	IPR002100	Transcription factor, MADS-box
CDD	cd00265	2.36E-37	2	61	No hit	No description
SuperFamily	SSF55455	8.37E-32	2	72	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.1E-33	3	23	IPR002100	Transcription factor, MADS-box
PROSITE pattern	PS00350	0	3	57	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	2.8E-27	10	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.1E-33	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.1E-33	38	59	IPR002100	Transcription factor, MADS-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 89 aa Download sequence Send to blast
MGRGRVELKR IENKINRQVT FAKRRNGLLK KAYELSVLCD AEVALIIFSN RGKLYEFCSS 60 SRSVTEYRKI LSSQVRYNRN LSKQDLTLK

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
5f28_A	7e-21	1	78	1	73	MEF2C
5f28_B	7e-21	1	78	1	73	MEF2C
5f28_C	7e-21	1	78	1	73	MEF2C
5f28_D	7e-21	1	78	1	73	MEF2C
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor that binds specifically to the CArG box DNA sequence 5'-CC (A/T)6 GG-3' (PubMed:7632923, PubMed:25183521). Plays an important role in the determination of flower meristem identity. Involved in the specification of sepal identity. Contributes to the development of petals, stamens and carpels (PubMed:15530395). {ECO:0000269\|PubMed:15530395, ECO:0000269\|PubMed:25183521, ECO:0000269\|PubMed:7632923}.

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	GU048641	2e-75	GU048641.1 Nelumbo nucifera voucher FLAS:Yoo & Koh 1002 SEP1 (SEP1) mRNA, partial cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_973411.1	1e-37	K-box region and MADS-box transcription factor family protein
Swissprot	P29383	2e-38	AGL3_ARATH; Agamous-like MADS-box protein AGL3
TrEMBL	A0A438DXH4	2e-38	A0A438DXH4_VITVI; Agamous-like MADS-box protein AGL9-like
STRING	cassava4.1_030388m	5e-38	(Manihot esculenta)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G03710.3	4e-41	MIKC_MADS family protein

Publications ? help Back to Top
Maejima K, et al. Degradation of class E MADS-domain transcription factors in Arabidopsis by a phytoplasmal effector, phyllogen. Plant Signal Behav, 2015. 10(8): p. e1042635 [PMID:26179462]