![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | NNU_010128-RA | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
|
||||||||
| Family | WRKY | ||||||||
| Protein Properties | Length: 128aa MW: 14552.7 Da PI: 9.6239 | ||||||||
| Description | WRKY family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | WRKY | 98.3 | 5e-31 | 42 | 100 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59
+dDg++WrKYG+K+vk+s++pr+YYrC+s gC+vkk+ver++ed ++v++tYeg Hnhe
NNU_010128-RA 42 MDDGFKWRKYGKKTVKNSPNPRNYYRCSSGGCNVKKRVERDREDSSYVITTYEGVHNHE 100
69********************************************************8 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:2.20.25.80 | 2.0E-33 | 30 | 102 | IPR003657 | WRKY domain |
| SuperFamily | SSF118290 | 2.09E-28 | 34 | 102 | IPR003657 | WRKY domain |
| PROSITE profile | PS50811 | 31.364 | 37 | 102 | IPR003657 | WRKY domain |
| SMART | SM00774 | 8.0E-35 | 42 | 101 | IPR003657 | WRKY domain |
| Pfam | PF03106 | 9.1E-25 | 43 | 100 | IPR003657 | WRKY domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0009867 | Biological Process | jasmonic acid mediated signaling pathway | ||||
| GO:0042742 | Biological Process | defense response to bacterium | ||||
| GO:0050832 | Biological Process | defense response to fungus | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 128 aa Download sequence Send to blast |
MIFTLLVVCS CGCRKCKGGL KKIKTDAGFR IAFRTKSELE IMDDGFKWRK YGKKTVKNSP 60 NPRNYYRCSS GGCNVKKRVE RDREDSSYVI TTYEGVHNHE SPCVVYYNEM PLMVPSGWTL 120 QASNSSSS |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 2ayd_A | 2e-26 | 30 | 102 | 2 | 74 | WRKY transcription factor 1 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). Involved in defense responses. May act as positive regulator of salicylic acid (SA)-mediated signaling and negative regulator of jasmonic acid (JA)-mediated signaling (PubMed:21030507). {ECO:0000250, ECO:0000269|PubMed:21030507}. | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_010261070.1 | 1e-80 | PREDICTED: probable WRKY transcription factor 51 isoform X1 | ||||
| Refseq | XP_019053770.1 | 7e-81 | PREDICTED: probable WRKY transcription factor 51 isoform X2 | ||||
| Swissprot | Q93WU9 | 2e-42 | WRK51_ARATH; Probable WRKY transcription factor 51 | ||||
| TrEMBL | A0A1U8A7M3 | 3e-79 | A0A1U8A7M3_NELNU; probable WRKY transcription factor 51 isoform X1 | ||||
| TrEMBL | A0A1U8Q6S7 | 2e-79 | A0A1U8Q6S7_NELNU; probable WRKY transcription factor 51 isoform X2 | ||||
| STRING | XP_010261070.1 | 5e-80 | (Nelumbo nucifera) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G64810.1 | 5e-45 | WRKY DNA-binding protein 51 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




