PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

NNU_010652-RA

Organism

Nelumbo nucifera

Taxonomic ID

4432

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo

Family

MYB

Protein Properties

Length: 156aa MW: 17729.5 Da PI: 10.5422

Description

MYB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
NNU_010652-RA	genome	CAS	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	21.6	5e-07	14	43	1	30
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIart 30 rg+WT Ed +l+d+++ +G g W+ +++ NNU_010652-RA 14 RGAWTVYEDRILIDYINTHGDGKWRELPKK 43 89***********************99886 PP
2	Myb_DNA-binding	56.7	5.7e-18	48	92	1	47
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 rg+ +teE+el+++++k+lG++ W++Ia +++ gRt++++k++w++ NNU_010652-RA 48 RGNISTEEEELIIRLHKLLGNR-WSLIAGRLP-GRTDNEIKNYWNTN 92 7999****************.*****.*********986 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.60	9.4E-10	5	43	IPR009057	Homeodomain-like
PROSITE profile	PS50090	6.748	9	42	IPR017877	Myb-like domain
SuperFamily	SSF46689	4.21E-19	12	89	IPR009057	Homeodomain-like
PROSITE profile	PS51294	24.669	43	97	IPR017930	Myb domain
Gene3D	G3DSA:1.10.10.60	3.9E-22	44	97	IPR009057	Homeodomain-like
SMART	SM00717	2.4E-16	47	95	IPR001005	SANT/Myb domain
Pfam	PF00249	9.9E-16	48	93	IPR001005	SANT/Myb domain
CDD	cd00167	3.30E-12	52	93	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 156 aa Download sequence Send to blast
MGRSPCCVKE GLNRGAWTVY EDRILIDYIN THGDGKWREL PKKADIKRGN ISTEEEELII 60 RLHKLLGNRW SLIAGRLPGR TDNEIKNYWN TNLSKKLQAG HHTPEKQVVI NKSKGKKMVE 120 AAGTSALSTL SPKVSQEPPR VIRTKDVRCT RVFFPP

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1h8a_C	1e-16	12	97	25	128	MYB TRANSFORMING PROTEIN
Search in ModeBase

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By nitrogen, salicylic acid, NaCl and abscisic acid (ABA). {ECO:0000269\|PubMed:16463103, ECO:0000269\|PubMed:18541146, ECO:0000269\|PubMed:9839469}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_010262233.1	1e-95	PREDICTED: transcription repressor MYB6-like
Swissprot	Q9S9K9	1e-43	MYB3_ARATH; Transcription factor MYB3
TrEMBL	A0A1U8AIF6	3e-94	A0A1U8AIF6_NELNU; transcription repressor MYB6-like
STRING	XP_010262233.1	5e-95	(Nelumbo nucifera)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G22640.1	4e-46	myb domain protein 3

Publications ? help Back to Top
Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Zhou M, et al. Changing a conserved amino acid in R2R3-MYB transcription repressors results in cytoplasmic accumulation and abolishes their repressive activity in Arabidopsis. Plant J., 2015. 84(2): p. 395-403 [PMID:26332741] Wada T,Hayashi N,Tominaga-Wada R Root hair formation at the root-hypocotyl junction in CPC-LIKE MYB double and triple mutants of Arabidopsis. Plant Signal Behav, 2015. 10(11): p. e1089372 [PMID:26339713] Wada T,Tominaga-Wada R CAPRICE family genes control flowering time through both promoting and repressing CONSTANS and FLOWERING LOCUS T expression. Plant Sci., 2015. 241: p. 260-5 [PMID:26706076] Song L, et al. A transcription factor hierarchy defines an environmental stress response network. Science, 2017. [PMID:27811239] Zhou M, et al. LNK1 and LNK2 Corepressors Interact with the MYB3 Transcription Factor in Phenylpropanoid Biosynthesis. Plant Physiol., 2017. 174(3): p. 1348-1358 [PMID:28483877] Mondal SK,Roy S Genome-wide sequential, evolutionary, organizational and expression analyses of phenylpropanoid biosynthesis associated MYB domain transcription factors in Arabidopsis. J. Biomol. Struct. Dyn., 2018. 36(6): p. 1577-1601 [PMID:28490275]