![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | NNU_010692-RA | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
|
||||||||
| Family | WRKY | ||||||||
| Protein Properties | Length: 105aa MW: 11852.7 Da PI: 10.4717 | ||||||||
| Description | WRKY family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | WRKY | 100 | 1.4e-31 | 43 | 101 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59
+dDg++W+KYG+K+vk+ +fpr+YYrC+ +gCpvkk++er+a+dp+ v++tYeg+Hnhe
NNU_010692-RA 43 MDDGFKWKKYGKKMVKNRPFPRNYYRCSVEGCPVKKRIERDADDPQHVITTYEGTHNHE 101
69********************************************************8 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:2.20.25.80 | 9.1E-34 | 31 | 103 | IPR003657 | WRKY domain |
| SuperFamily | SSF118290 | 5.23E-29 | 35 | 103 | IPR003657 | WRKY domain |
| PROSITE profile | PS50811 | 30.435 | 38 | 103 | IPR003657 | WRKY domain |
| SMART | SM00774 | 8.2E-33 | 43 | 102 | IPR003657 | WRKY domain |
| Pfam | PF03106 | 2.6E-25 | 44 | 101 | IPR003657 | WRKY domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 105 aa Download sequence Send to blast |
MTPAIAAALK LKGLAGVTCK RRGTNKAVGA RVVFRTKTEL DIMDDGFKWK KYGKKMVKNR 60 PFPRNYYRCS VEGCPVKKRI ERDADDPQHV ITTYEGTHNH ESPSA |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 2ayd_A | 3e-28 | 30 | 103 | 1 | 74 | WRKY transcription factor 1 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_028062068.1 | 4e-41 | probable WRKY transcription factor 50 isoform X1 | ||||
| Swissprot | Q8VWQ5 | 9e-39 | WRK50_ARATH; Probable WRKY transcription factor 50 | ||||
| TrEMBL | A0A2P2J0H4 | 3e-38 | A0A2P2J0H4_RHIMU; Uncharacterized protein WRKY transcription factor 14 | ||||
| STRING | XP_010273969.1 | 2e-46 | (Nelumbo nucifera) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G26170.1 | 1e-40 | WRKY DNA-binding protein 50 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




