![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | NNU_015895-RA | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
|
||||||||
| Family | NF-YB | ||||||||
| Protein Properties | Length: 139aa MW: 15841.7 Da PI: 4.4664 | ||||||||
| Description | NF-YB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YB | 130.9 | 4.3e-41 | 5 | 75 | 27 | 97 |
NF-YB 27 iskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97
+skdaketvqecvsefisfvt+easdkcqrekrktingdd++wa++tlGfe+yv+plk+yl+kyre+egek
NNU_015895-RA 5 VSKDAKETVQECVSEFISFVTGEASDKCQREKRKTINGDDIIWAISTLGFENYVNPLKLYLQKYREMEGEK 75
89******************************************************************996 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Pfam | PF00808 | 3.7E-18 | 3 | 49 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| SuperFamily | SSF47113 | 7.58E-31 | 4 | 94 | IPR009072 | Histone-fold |
| Gene3D | G3DSA:1.10.20.10 | 7.4E-39 | 4 | 98 | IPR009072 | Histone-fold |
| PRINTS | PR00615 | 2.8E-21 | 13 | 31 | No hit | No description |
| PROSITE pattern | PS00685 | 0 | 16 | 32 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
| PRINTS | PR00615 | 2.8E-21 | 32 | 50 | No hit | No description |
| PRINTS | PR00615 | 2.8E-21 | 51 | 69 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 139 aa Download sequence Send to blast |
MVEMVSKDAK ETVQECVSEF ISFVTGEASD KCQREKRKTI NGDDIIWAIS TLGFENYVNP 60 LKLYLQKYRE MEGEKLNVPK QQQEQQVASS DNVNSSAHLT SQPSLLYSTN QPFSMPFSPS 120 SIQQQMQQQE PNDSLGQWL |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1n1j_A | 5e-33 | 5 | 70 | 28 | 93 | NF-YB |
| 4awl_B | 4e-33 | 5 | 70 | 29 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
| 4csr_A | 4e-33 | 5 | 70 | 29 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_010270446.1 | 9e-96 | PREDICTED: nuclear transcription factor Y subunit B-3 | ||||
| Swissprot | Q9SIT9 | 2e-47 | NFYB7_ARATH; Nuclear transcription factor Y subunit B-7 | ||||
| TrEMBL | A0A1U8AV96 | 2e-94 | A0A1U8AV96_NELNU; nuclear transcription factor Y subunit B-3 | ||||
| STRING | XP_010270446.1 | 3e-95 | (Nelumbo nucifera) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G13570.1 | 1e-45 | nuclear factor Y, subunit B7 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




