PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

NNU_018788-RA

Organism

Nelumbo nucifera

Taxonomic ID

4432

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo

Family

MYB_related

Protein Properties

Length: 83aa MW: 9858.53 Da PI: 9.4657

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
NNU_018788-RA	genome	CAS	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	50.4	5e-16	9	56	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT+eEd ll ++++++G g W +++ + g++R++k c++rw++yl NNU_018788-RA 9 KGAWTEEEDILLRKCIERYGEGEWCKVPLRAGLNRCRKRCRLRWLNYL 56 79*********************************************7 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	22.724	1	60	IPR017930	Myb domain
Gene3D	G3DSA:1.10.10.60	2.6E-21	7	59	IPR009057	Homeodomain-like
SMART	SM00717	2.5E-13	8	58	IPR001005	SANT/Myb domain
Pfam	PF00249	2.6E-15	9	56	IPR001005	SANT/Myb domain
SuperFamily	SSF46689	9.9E-21	10	83	IPR009057	Homeodomain-like
CDD	cd00167	7.95E-10	11	56	No hit	No description
Gene3D	G3DSA:1.10.10.60	1.6E-6	60	83	IPR009057	Homeodomain-like

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 83 aa Download sequence Send to blast
MDCGLGLRKG AWTEEEDILL RKCIERYGEG EWCKVPLRAG LNRCRKRCRL RWLNYLRPGI 60 NRGQFTSDEV DLIIWLHKLL GNR

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription activator, when associated with BHLH002/EGL3/MYC146, BHLH012/MYC1, or BHLH042/TT8. {ECO:0000269\|PubMed:15361138}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_010274761.1	2e-46	PREDICTED: myb-related protein 330-like
Swissprot	Q9FNV9	5e-37	MY113_ARATH; Transcription factor MYB113
TrEMBL	A0A1L2BPH7	1e-45	A0A1L2BPH7_NELNU; MYB transcription factor 5 (Fragment)
TrEMBL	A0A1U8B239	4e-45	A0A1U8B239_NELNU; myb-related protein 330-like
STRING	XP_010274761.1	6e-46	(Nelumbo nucifera)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G66370.1	2e-39	myb domain protein 113

Publications ? help Back to Top
Li T, et al. Jasmonic acid enhancement of anthocyanin accumulation is dependent on phytochrome A signaling pathway under far-red light in Arabidopsis. Biochem. Biophys. Res. Commun., 2014. 454(1): p. 78-83 [PMID:25450360] Mondal SK,Roy S Genome-wide sequential, evolutionary, organizational and expression analyses of phenylpropanoid biosynthesis associated MYB domain transcription factors in Arabidopsis. J. Biomol. Struct. Dyn., 2018. 36(6): p. 1577-1601 [PMID:28490275]