![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | NNU_021998-RA | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
|
||||||||
| Family | NF-YB | ||||||||
| Protein Properties | Length: 121aa MW: 13180.9 Da PI: 5.2184 | ||||||||
| Description | NF-YB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YB | 172.3 | 5.3e-54 | 31 | 121 | 2 | 92 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyre 92
reqdrflPian+srimkkv+P n+ki+kdak+ vqecvsefisf+tseasdkcqrekrktingddllwa+atlGfedy++plk+yl+ yre
NNU_021998-RA 31 REQDRFLPIANISRIMKKVIPPNGKIAKDAKDCVQECVSEFISFITSEASDKCQREKRKTINGDDLLWAMATLGFEDYIAPLKMYLQLYRE 121
89****************************************************************************************8 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.20.10 | 1.7E-50 | 28 | 121 | IPR009072 | Histone-fold |
| SuperFamily | SSF47113 | 6.21E-38 | 33 | 121 | IPR009072 | Histone-fold |
| Pfam | PF00808 | 7.9E-29 | 36 | 100 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| PRINTS | PR00615 | 9.7E-20 | 64 | 82 | No hit | No description |
| PROSITE pattern | PS00685 | 0 | 67 | 83 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
| PRINTS | PR00615 | 9.7E-20 | 83 | 101 | No hit | No description |
| PRINTS | PR00615 | 9.7E-20 | 102 | 120 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 121 aa Download sequence Send to blast |
MAESGAPGTP ESVHSGEQGG GGAQSGGTGP REQDRFLPIA NISRIMKKVI PPNGKIAKDA 60 KDCVQECVSE FISFITSEAS DKCQREKRKT INGDDLLWAM ATLGFEDYIA PLKMYLQLYR 120 E |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1n1j_A | 5e-48 | 31 | 121 | 3 | 93 | NF-YB |
| 4awl_B | 5e-48 | 31 | 121 | 4 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
| 4csr_A | 5e-48 | 31 | 121 | 4 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. | |||||
| UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_010279615.1 | 2e-86 | PREDICTED: nuclear transcription factor Y subunit B-3-like isoform X3 | ||||
| Swissprot | P25209 | 7e-58 | NFYB_MAIZE; Nuclear transcription factor Y subunit B | ||||
| Swissprot | Q9SLG0 | 7e-58 | NFYB1_ARATH; Nuclear transcription factor Y subunit B-1 | ||||
| TrEMBL | A0A1U8BHB7 | 5e-85 | A0A1U8BHB7_NELNU; nuclear transcription factor Y subunit B-3-like isoform X3 | ||||
| STRING | XP_010279613.1 | 3e-85 | (Nelumbo nucifera) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G38880.3 | 1e-58 | nuclear factor Y, subunit B1 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




