 |
Plant Transcription
Factor Database
|
Transcription Factor Information
|
Basic
Information? help
Back to Top |
| TF ID |
NNU_024574-RA |
| Organism |
|
| Taxonomic ID |
|
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
|
| Family |
GRAS |
| Protein Properties |
Length: 97aa MW: 10979.6 Da PI: 4.6414 |
| Description |
GRAS family protein |
| Gene Model |
| Gene Model ID |
Type |
Source |
Coding Sequence |
| NNU_024574-RA | genome | CAS | View CDS |
|
| Signature Domain? help Back to Top |
 |
| No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
| 1 | GRAS | 78.7 | 1.1e-24 | 1 | 93 | 207 | 302 |
GRAS 207 vlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvaceg 302
+lql++llde++ + + L+l ksl+Pkvv++ e ea +n+ +Fl+ f al+yysa+f+sle +l r+s eri +E llgr+i+ vv e+
NNU_024574-RA 1 MLQLYNLLDETTVAME---RALRLAKSLKPKVVTLGEYEAGLNRVDFLNSFKTALQYYSAVFESLEPSLTRDSTERIQIESLLLGRQISGVVEPEE 93
5789999987766666...8************************************************************************9775 PP
|
| Functional Description ? help
Back to Top |
| Source |
Description |
| UniProt | Probable transcription factor involved in plant development (By similarity). Involved in environmental abiotic stress resistance. May increase the expression of stress-responsive genes (PubMed:20616154). Binds DNA in vitro (By similarity). {ECO:0000250|UniProtKB:Q53K16, ECO:0000250|UniProtKB:Q9SCR0, ECO:0000269|PubMed:20616154}. |
| Regulation -- Description ? help
Back to Top |
| Source |
Description |
| UniProt | INDUCTION: Up-regulated by drought and high salt stresses, and down-regulated by gibberellic acid (GA) treatment, but not by plant hormone abscisic acid (ABA) application in leaves. Under the salt treatment, expression is induced quickly, and it peaks at 3 hours. Under the drought treatment, the expression is not induced immediately, but reaches its maximum at 3 hours. Under the GA treatment, the expression becomes weaker within 5 hours. {ECO:0000269|PubMed:20616154}. |
