![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Neem_15977_f_1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
|
||||||||
| Family | CAMTA | ||||||||
| Protein Properties | Length: 112aa MW: 12931.1 Da PI: 10.7492 | ||||||||
| Description | CAMTA family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | CG-1 | 84.9 | 8.7e-27 | 21 | 94 | 3 | 77 |
CG-1 3 kekkrwlkneeiaaiLenfekheltlelktrpksgsliLynrkkvryfrkDGyswkkkkdgktvrEdhekLKvgg 77
+ k+rwl + e+++iL n++k+++ +++++ p+sg++ + ++vr+fr+DG++w+kk+dgktv+E+h+kLKv +
Neem_15977_f_1 21 QAKHRWLSAAEVCEILRNYQKFSVDSKPANMPPSGKMPIC-LEVVRFFRNDGHNWRKKRDGKTVKEAHKKLKVST 94
569*********************************9865.68******************************87 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51437 | 31.307 | 15 | 112 | IPR005559 | CG-1 DNA-binding domain |
| SMART | SM01076 | 4.8E-14 | 18 | 110 | IPR005559 | CG-1 DNA-binding domain |
| Pfam | PF03859 | 1.8E-22 | 22 | 98 | IPR005559 | CG-1 DNA-binding domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 112 aa Download sequence Send to blast |
MAETGRFADG NQLDMEKLRV QAKHRWLSAA EVCEILRNYQ KFSVDSKPAN MPPSGKMPIC 60 LEVVRFFRND GHNWRKKRDG KTVKEAHKKL KVSTKFIIFQ KIGPTLSSLK EI |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription activator that binds to the DNA consensus sequence 5'-[ACG]CGCG[GTC]-3' (By similarity). Regulates transcriptional activity in response to calcium signals (Probable). Binds calmodulin in a calcium-dependent manner (By similarity). Involved in freezing tolerance in association with CAMTA1 and CAMTA3. Contributes together with CAMTA1 and CAMTA3 to the positive regulation of the cold-induced expression of DREB1A/CBF3, DREB1B/CBF1 and DREB1C/CBF2 (PubMed:23581962). Involved together with CAMTA3 and CAMTA4 in the positive regulation of a general stress response (PubMed:25039701). Involved in tolerance to aluminum. Binds to the promoter of ALMT1 transporter and contributes to the positive regulation of aluminum-induced expression of ALMT1 (PubMed:25627216). {ECO:0000250|UniProtKB:Q8GSA7, ECO:0000269|PubMed:23581962, ECO:0000269|PubMed:25039701, ECO:0000269|PubMed:25627216, ECO:0000305|PubMed:11925432}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: By salt, wounding, abscisic acid, H(2)O(2) and salicylic acid (PubMed:12218065). Induced by aluminum (PubMed:25627216). {ECO:0000269|PubMed:12218065, ECO:0000269|PubMed:25627216}. | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_018847035.1 | 4e-34 | PREDICTED: calmodulin-binding transcription activator 3 | ||||
| Swissprot | Q6NPP4 | 2e-31 | CMTA2_ARATH; Calmodulin-binding transcription activator 2 | ||||
| TrEMBL | A0A1J3HQ35 | 4e-33 | A0A1J3HQ35_NOCCA; Calmodulin-binding transcription activator 2 (Fragment) | ||||
| TrEMBL | A0A2I4GT10 | 9e-33 | A0A2I4GT10_JUGRE; calmodulin-binding transcription activator 3 | ||||
| STRING | XP_008369913.1 | 9e-37 | (Malus domestica) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G64220.2 | 8e-34 | Calmodulin-binding transcription activator protein with CG-1 and Ankyrin domains | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




