![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Neem_22985_f_3 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 75aa MW: 8617.4 Da PI: 4.259 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 36.2 | 1.4e-11 | 26 | 69 | 1 | 46 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
++ ++++E+ l+++ ++ G + W++Ia +++ gRt++++ +w++
Neem_22985_f_3 26 KLEFSEDEETLILRMYNLVGER-WALIAGRIP-GRTAEEIEKYWNT 69
678*******************.*********.***********96 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51294 | 12.316 | 21 | 75 | IPR017930 | Myb domain |
| SMART | SM00717 | 1.2E-9 | 25 | 73 | IPR001005 | SANT/Myb domain |
| Pfam | PF00249 | 1.3E-10 | 27 | 69 | IPR001005 | SANT/Myb domain |
| CDD | cd00167 | 1.20E-8 | 28 | 69 | No hit | No description |
| SuperFamily | SSF46689 | 4.37E-9 | 28 | 70 | IPR009057 | Homeodomain-like |
| Gene3D | G3DSA:1.10.10.60 | 3.7E-14 | 28 | 69 | IPR009057 | Homeodomain-like |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 75 aa Download sequence Send to blast |
MADSQHPSTI NNTTADSQEK TSEEPKLEFS EDEETLILRM YNLVGERWAL IAGRIPGRTA 60 EEIEKYWNTR NSTSE |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | MYB-type transcription factor involved in epidermal cell fate specification. Acts as a negative regulator of trichome development, by mediating lateral inhibition. Promotes the formation of hair developing cells in H position in root epidermis, probably by inhibiting non-hair cell formation. {ECO:0000269|PubMed:15063185, ECO:0000269|PubMed:15584952}. | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_021887356.1 | 1e-36 | MYB-like transcription factor ETC1 | ||||
| Swissprot | Q9LNI5 | 8e-17 | ETC1_ARATH; MYB-like transcription factor ETC1 | ||||
| TrEMBL | A0A218WYL8 | 3e-34 | A0A218WYL8_PUNGR; Uncharacterized protein | ||||
| TrEMBL | A0A438JG76 | 4e-34 | A0A438JG76_VITVI; Transcription factor CPC | ||||
| TrEMBL | E0CVL2 | 4e-34 | E0CVL2_VITVI; Uncharacterized protein | ||||
| TrEMBL | U5GK03 | 3e-34 | U5GK03_POPTR; Uncharacterized protein | ||||
| STRING | VIT_10s0116g00500.t01 | 6e-35 | (Vitis vinifera) | ||||
| STRING | POPTR_0004s02060.1 | 5e-35 | (Populus trichocarpa) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM323 | 28 | 194 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G01380.1 | 4e-19 | MYB_related family protein | ||||




