![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Neem_24864_a_2 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
|
||||||||
| Family | HSF | ||||||||
| Protein Properties | Length: 96aa MW: 11064.6 Da PI: 4.5205 | ||||||||
| Description | HSF family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | HSF_DNA-bind | 83.7 | 2.6e-26 | 16 | 74 | 2 | 60 |
HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHT CS
HSF_DNA-bind 2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmY 60
Flkk ye+++d++++++isws+n+ sfv++d++ef+ ++LpkyFkhsnfaSF+RQLn+Y
Neem_24864_a_2 16 FLKKCYEMVDDQSTDSIISWSQNNVSFVIWDMTEFSVQLLPKYFKHSNFASFIRQLNIY 74
9********************************************************** PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.10.10 | 1.3E-26 | 9 | 75 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
| SMART | SM00415 | 1.2E-19 | 12 | 91 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| SuperFamily | SSF46785 | 2.36E-23 | 12 | 83 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
| Pfam | PF00447 | 5.7E-21 | 16 | 74 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| PRINTS | PR00056 | 1.8E-15 | 16 | 39 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| PRINTS | PR00056 | 1.8E-15 | 54 | 66 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| PRINTS | PR00056 | 1.8E-15 | 67 | 79 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 96 aa Download sequence Send to blast |
MVKSNDDGSG ASVAPFLKKC YEMVDDQSTD SIISWSQNNV SFVIWDMTEF SVQLLPKYFK 60 HSNFASFIRQ LNIYVSFFVF LFDLMGNSLF SFYAPI |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5d5u_B | 5e-17 | 8 | 74 | 17 | 87 | Heat shock factor protein 1 |
| 5d5v_B | 5e-17 | 8 | 74 | 17 | 87 | Heat shock factor protein 1 |
| 5d5v_D | 5e-17 | 8 | 74 | 17 | 87 | Heat shock factor protein 1 |
| 5hdk_A | 3e-17 | 13 | 74 | 7 | 68 | Heat shock factor protein 2 |
| 5hdk_B | 3e-17 | 13 | 74 | 7 | 68 | Heat shock factor protein 2 |
| 5hdk_C | 3e-17 | 13 | 74 | 7 | 68 | Heat shock factor protein 2 |
| 5hdk_D | 3e-17 | 13 | 74 | 7 | 68 | Heat shock factor protein 2 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcriptional activator that specifically binds DNA sequence 5'-AGAAnnTTCT-3' known as heat shock promoter elements (HSE). | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_006448139.1 | 2e-37 | heat stress transcription factor A-8 | ||||
| Swissprot | Q9S7U5 | 2e-26 | HSFA8_ARATH; Heat stress transcription factor A-8 | ||||
| TrEMBL | A0A067FBG6 | 5e-36 | A0A067FBG6_CITSI; Uncharacterized protein | ||||
| TrEMBL | A0A2P2JGW8 | 4e-39 | A0A2P2JGW8_RHIMU; Uncharacterized protein | ||||
| TrEMBL | V4W5N3 | 5e-36 | V4W5N3_9ROSI; Uncharacterized protein | ||||
| STRING | XP_006448138.1 | 8e-37 | (Citrus clementina) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM965 | 28 | 111 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G67970.1 | 8e-29 | heat shock transcription factor A8 | ||||




