![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Neem_25391_f_1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
|
||||||||
| Family | HSF | ||||||||
| Protein Properties | Length: 70aa MW: 8152.16 Da PI: 5.6782 | ||||||||
| Description | HSF family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | HSF_DNA-bind | 87.6 | 1.6e-27 | 10 | 68 | 2 | 60 |
HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHT CS
HSF_DNA-bind 2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmY 60
Fl+k+y++++d++++++isw+e+g++fvv+++ +fak++Lp+yFkh+nf+SFvRQLn+Y
Neem_25391_f_1 10 FLMKTYQLVDDPNTDDVISWNESGTTFVVWKTADFAKDLLPNYFKHNNFSSFVRQLNTY 68
9*********************************************************9 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.10.10 | 1.2E-28 | 3 | 68 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
| SMART | SM00415 | 1.4E-20 | 6 | 70 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| SuperFamily | SSF46785 | 2.84E-24 | 7 | 68 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
| PRINTS | PR00056 | 1.4E-17 | 10 | 33 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| Pfam | PF00447 | 1.3E-22 | 10 | 68 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| PRINTS | PR00056 | 1.4E-17 | 48 | 60 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| PRINTS | PR00056 | 1.4E-17 | 61 | 70 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 70 aa Download sequence Send to blast |
MTQRTVPAPF LMKTYQLVDD PNTDDVISWN ESGTTFVVWK TADFAKDLLP NYFKHNNFSS 60 FVRQLNTYVS |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5d5u_B | 2e-19 | 6 | 68 | 26 | 87 | Heat shock factor protein 1 |
| 5d5v_B | 2e-19 | 6 | 68 | 26 | 87 | Heat shock factor protein 1 |
| 5d5v_D | 2e-19 | 6 | 68 | 26 | 87 | Heat shock factor protein 1 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | DNA-binding protein that specifically binds heat shock promoter elements (HSE) and activates transcription. | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_021656118.1 | 5e-42 | heat shock factor protein HSF24 | ||||
| Swissprot | P22335 | 8e-39 | HSF24_SOLPE; Heat shock factor protein HSF24 | ||||
| TrEMBL | A0A2H5PJX4 | 4e-40 | A0A2H5PJX4_CITUN; Uncharacterized protein | ||||
| STRING | XP_006466606.1 | 7e-41 | (Citrus sinensis) | ||||
| STRING | XP_006425895.1 | 1e-40 | (Citrus clementina) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM965 | 28 | 111 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G36990.1 | 6e-39 | heat shock factor 4 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




