![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Neem_2547_f_4 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
|
||||||||
| Family | HSF | ||||||||
| Protein Properties | Length: 120aa MW: 13662.6 Da PI: 9.1627 | ||||||||
| Description | HSF family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | HSF_DNA-bind | 87.6 | 1.6e-27 | 18 | 78 | 2 | 62 |
HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHTTE CS
HSF_DNA-bind 2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmYgF 62
Fl+k+y+++ed+++++++sws+ +nsfvv++ ef++++LpkyFkhsnf+SFvRQLn+Y+F
Neem_2547_f_4 18 FLSKIYDLVEDSSTNDIVSWSTGNNSFVVWKVAEFSRDLLPKYFKHSNFSSFVRQLNTYEF 78
9***********************************************************9 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.10.10 | 3.4E-28 | 9 | 78 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
| SMART | SM00415 | 1.1E-27 | 14 | 102 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| SuperFamily | SSF46785 | 7.89E-25 | 16 | 90 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
| Pfam | PF00447 | 5.9E-23 | 18 | 79 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| PRINTS | PR00056 | 6.7E-16 | 18 | 41 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| PRINTS | PR00056 | 6.7E-16 | 56 | 68 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| PRINTS | PR00056 | 6.7E-16 | 69 | 81 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 120 aa Download sequence Send to blast |
MEAMPSSSAA NGNSLPPFLS KIYDLVEDSS TNDIVSWSTG NNSFVVWKVA EFSRDLLPKY 60 FKHSNFSSFV RQLNTYEFWG NIGQKCRILC AMDTSLSSVS RSIYLAAFKF LKMNVNMMRF |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5d5u_B | 4e-19 | 4 | 78 | 14 | 89 | Heat shock factor protein 1 |
| 5d5v_B | 4e-19 | 4 | 78 | 14 | 89 | Heat shock factor protein 1 |
| 5d5v_D | 4e-19 | 4 | 78 | 14 | 89 | Heat shock factor protein 1 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcriptional activator that specifically binds DNA sequence 5'-AGAAnnTTCT-3' known as heat shock promoter elements (HSE). | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_006443267.2 | 8e-35 | heat stress transcription factor A-1e | ||||
| Refseq | XP_006478966.1 | 8e-35 | heat stress transcription factor A-1e isoform X1 | ||||
| Refseq | XP_006478968.1 | 8e-35 | heat stress transcription factor A-1e isoform X1 | ||||
| Refseq | XP_024043699.1 | 8e-35 | heat stress transcription factor A-1e | ||||
| Refseq | XP_024954068.1 | 5e-35 | heat stress transcription factor A-1b isoform X2 | ||||
| Swissprot | Q9SCW5 | 1e-29 | HFA1E_ARATH; Heat stress transcription factor A-1e | ||||
| TrEMBL | A0A067EBM1 | 3e-33 | A0A067EBM1_CITSI; Uncharacterized protein | ||||
| STRING | XP_006478966.1 | 3e-34 | (Citrus sinensis) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM965 | 28 | 111 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G02990.1 | 5e-32 | heat shock transcription factor A1E | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




