PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Neem_25739_f_2

Organism

Azadirachta indica

Taxonomic ID

124943

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta

Family

MYB_related

Protein Properties

Length: 79aa MW: 8772.78 Da PI: 5.8183

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Neem_25739_f_2	genome	NGD	View Nucleic Acid

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	34.9	3.7e-11	36	67	1	32
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmg 32 rg+WT eEd +l+++++ +G g+W++ ar+ g Neem_25739_f_2 36 RGPWTVEEDFKLINYIANHGEGRWNSLARCAG 67 89****************************98 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.60	4.0E-11	28	65	IPR009057	Homeodomain-like
SuperFamily	SSF46689	2.39E-9	31	67	IPR009057	Homeodomain-like
PROSITE profile	PS51294	10.503	31	79	IPR017930	Myb domain
SMART	SM00717	5.2E-4	35	75	IPR001005	SANT/Myb domain
Pfam	PF00249	1.3E-8	36	67	IPR001005	SANT/Myb domain
CDD	cd00167	1.66E-6	38	67	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 79 aa Download sequence Send to blast
MEVKAAAGGG RSRYCSSSSN SSIQSDQESA DMDLRRGPWT VEEDFKLINY IANHGEGRWN 60 SLARCAGFFL KVLKETDLL

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor contributing to the regulation of stamen maturation and male fertility in response to jasmonate signaling. Required for correct timing of anther dehiscence. Acts as a negative regulator of abscisic acid-induced cell death. Not involved in the regulation of BOI. Regulated by MYB21 and at a lower level by MYB24. Negatively regulated by the proteasome in an SCF(COI1) E3 ubiquitin-protein ligase complex-dependent manner. {ECO:0000269\|PubMed:14555693, ECO:0000269\|PubMed:19091873, ECO:0000269\|PubMed:20921156, ECO:0000269\|PubMed:23952703}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Up-regulated by jasmonate and pathogen infection. {ECO:0000269\|PubMed:14555693, ECO:0000269\|PubMed:19091873}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_007227100.1	2e-20	transcription factor MYB108
Swissprot	Q9LDE1	8e-17	MY108_ARATH; Transcription factor MYB108
TrEMBL	M1AGY2	5e-20	M1AGY2_SOLTU; Uncharacterized protein
TrEMBL	M5XQV5	5e-19	M5XQV5_PRUPE; Uncharacterized protein
STRING	EMJ28299	8e-20	(Prunus persica)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G49620.1	2e-19	myb domain protein 78

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Cheng HQ, et al. The cotton MYB108 forms a positive feedback regulation loop with CML11 and participates in the defense response against Verticillium dahliae infection. J. Exp. Bot., 2016. 67(6): p. 1935-50 [PMID:26873979] Sanz-Fernández M, et al. Screening Arabidopsis mutants in genes useful for phytoremediation. J. Hazard. Mater., 2017. 335: p. 143-151 [PMID:28441590] Chou ML, et al. The Direct Involvement of Dark-Induced Tic55 Protein in Chlorophyll Catabolism and Its Indirect Role in the MYB108-NAC Signaling Pathway during Leaf Senescence in Arabidopsis thaliana. Int J Mol Sci, 2018. [PMID:29937503]