PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Neem_30361_f_1

Organism

Azadirachta indica

Taxonomic ID

124943

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta

Family

NAC

Protein Properties

Length: 150aa MW: 17623.3 Da PI: 9.8928

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Neem_30361_f_1	genome	NGD	View Nucleic Acid

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	165.6	1.8e-51	6	132	1	128
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 lppGfrFhPtd elv++yLk+kv g+kl + +i+evdiyk+ PwdLp k ++++++ +wyfF++r+kky++g r nrat+ gyWk+tgkd++v+ Neem_30361_f_1 6 LPPGFRFHPTDVELVKYYLKRKVMGRKLYE--AIAEVDIYKFAPWDLPdKsCLRSGDLKWYFFCPREKKYSNGGRMNRATELGYWKTTGKDRPVH 98 79***********************665..8**********96347788889*********************************** PP NAM 94 skkgelvglkktLvfykgrapkgektdWvmheyrl 128 ++e+vg+ ktL+f++g+ap+g++tdWvmheyr+ Neem_30361_f_1 99 Y-NNEVVGMIKTLIFHRGKAPQGHRTDWVMHEYRI 132 .999***************************97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF101941	6.02E-55	3	145	IPR003441	NAC domain
PROSITE profile	PS51005	51.411	6	150	IPR003441	NAC domain
Pfam	PF02365	1.5E-27	7	132	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 150 aa Download sequence Send to blast
MAKTSLPPGF RFHPTDVELV KYYLKRKVMG RKLYEAIAEV DIYKFAPWDL PDKSCLRSGD 60 LKWYFFCPRE KKYSNGGRMN RATELGYWKT TGKDRPVHYN NEVVGMIKTL IFHRGKAPQG 120 HRTDWVMHEY RIDEKDLAER GVVQGVHALE

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
3ulx_A	4e-49	2	132	11	140	Stress-induced transcription factor NAC1
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcriptional regulator that binds specific DNA sequences on the promoter regions of target genes. {ECO:0000250\|UniProtKB:Q9C8W9}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_006432239.1	4e-91	NAC domain-containing protein 82 isoform X1
Refseq	XP_006432240.1	4e-91	NAC domain-containing protein 82 isoform X1
Refseq	XP_006464643.1	4e-91	NAC domain-containing protein 82-like
Refseq	XP_024039820.1	4e-91	NAC domain-containing protein 82 isoform X2
Refseq	XP_024039821.1	3e-91	NAC domain-containing protein 82 isoform X3
Swissprot	Q9FY82	1e-73	NAC82_ARATH; NAC domain-containing protein 82
TrEMBL	A0A067ET28	8e-90	A0A067ET28_CITSI; Uncharacterized protein
TrEMBL	A0A2H5PWZ5	8e-90	A0A2H5PWZ5_CITUN; Uncharacterized protein
TrEMBL	V4SD00	9e-90	V4SD00_9ROSI; Uncharacterized protein
TrEMBL	V4V129	9e-90	V4V129_9ROSI; Uncharacterized protein
STRING	XP_006464643.1	1e-90	(Citrus sinensis)
STRING	XP_006432239.1	1e-90	(Citrus clementina)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM3692	25	62

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G64060.1	2e-76	NAC domain containing protein 103

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Deeken R, et al. Identification of Arabidopsis thaliana phloem RNAs provides a search criterion for phloem-based transcripts hidden in complex datasets of microarray experiments. Plant J., 2008. 55(5): p. 746-59 [PMID:18485061] Ohbayashi I, et al. Evidence for a Role of ANAC082 as a Ribosomal Stress Response Mediator Leading to Growth Defects and Developmental Alterations in Arabidopsis. Plant Cell, 2017. 29(10): p. 2644-2660 [PMID:28899981]