PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Neem_30695_a_1

Organism

Azadirachta indica

Taxonomic ID

124943

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta

Family

MYB_related

Protein Properties

Length: 51aa MW: 5690.52 Da PI: 8.7766

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Neem_30695_a_1	genome	NGD	View Nucleic Acid

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	39.4	1.4e-12	14	44	1	31
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartm 31 +g+WT+eEd++lv++++++G g+W++ ++ Neem_30695_a_1 14 KGPWTPEEDQKLVKYIQKHGHGSWRALPKLA 44 79***********************999876 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.60	3.6E-15	5	47	IPR009057	Homeodomain-like
PROSITE profile	PS51294	13.585	9	51	IPR017930	Myb domain
SuperFamily	SSF46689	1.04E-10	11	43	IPR009057	Homeodomain-like
Pfam	PF00249	6.0E-11	14	44	IPR001005	SANT/Myb domain
CDD	cd00167	2.10E-7	16	42	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 51 aa Download sequence Send to blast
MGRSPCCDET GLKKGPWTPE EDQKLVKYIQ KHGHGSWRAL PKLADAGRVV D

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor that acts as negative regulator of lateral root (LR) development. Required for normal auxin responses during LR development. May be part of a negative feedback loop stimulated specifically in the endodermis upon LR initiation to ensure that LRs are formed only in the correct place. {ECO:0000269\|PubMed:24902892}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Induced by abscisic acid (ABA), auxin and gravity in roots. {ECO:0000269\|PubMed:24902892}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_011004803.1	3e-26	PREDICTED: transcription factor MYB39-like
Refseq	XP_024457048.1	2e-26	transcription factor MYB93 isoform X2
Swissprot	Q9S9Z2	3e-26	MYB93_ARATH; Transcription factor MYB93
TrEMBL	A0A3N7F5M4	4e-25	A0A3N7F5M4_POPTR; Uncharacterized protein
STRING	POPTR_0005s07590.1	2e-25	(Populus trichocarpa)
STRING	POPTR_0005s17080.1	2e-25	(Populus trichocarpa)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM4	28	2646

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G34670.1	1e-28	myb domain protein 93

Publications ? help Back to Top
Gibbs DJ,Coates JC AtMYB93 is an endodermis-specific transcriptional regulator of lateral root development in arabidopsis. Plant Signal Behav, 2014. 9(10): p. e970406 [PMID:25482809]