PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Neem_31430_f_1

Organism

Azadirachta indica

Taxonomic ID

124943

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta

Family

M-type_MADS

Protein Properties

Length: 61aa MW: 6821.02 Da PI: 11.0122

Description

M-type_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Neem_31430_f_1	genome	NGD	View Nucleic Acid

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	92.8	1.6e-29	10	59	2	51
---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 +i+n++ rqvtfskRr+g++KKA+ELS+LCdaev ++ifsstgklye+ss Neem_31430_f_1 10 KIDNSTSRQVTFSKRRKGLIKKAKELSILCDAEVGLVIFSSTGKLYEFSS 59 79**********************************************96 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00432	6.6E-39	1	60	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS50066	31.076	1	61	IPR002100	Transcription factor, MADS-box
SuperFamily	SSF55455	8.37E-29	2	60	IPR002100	Transcription factor, MADS-box
CDD	cd00265	5.97E-35	2	60	No hit	No description
PRINTS	PR00404	6.9E-29	3	23	IPR002100	Transcription factor, MADS-box
PROSITE pattern	PS00350	0	3	57	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	6.0E-27	10	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	6.9E-29	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	6.9E-29	38	59	IPR002100	Transcription factor, MADS-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 61 aa Download sequence Send to blast
MGRGKIVIQK IDNSTSRQVT FSKRRKGLIK KAKELSILCD AEVGLVIFSS TGKLYEFSST 60 R

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
5f28_A	7e-20	1	60	1	60	MEF2C
5f28_B	7e-20	1	60	1	60	MEF2C
5f28_C	7e-20	1	60	1	60	MEF2C
5f28_D	7e-20	1	60	1	60	MEF2C
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcriptional factor that targets the CArG motif 5'-C(A/T)TTAAAAAG-3' in the promoter of D14. Directly suppresses D14 expression to control the outgrowth of axillary buds. {ECO:0000269\|PubMed:23463009}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_006426227.2	3e-33	MADS-box transcription factor 23
Refseq	XP_006466574.1	3e-33	MADS-box transcription factor 23-like
Refseq	XP_018813443.1	2e-33	PREDICTED: MADS-box transcription factor 27-like isoform X3
Refseq	XP_022741403.1	2e-33	agamous-like MADS-box protein AGL21
Swissprot	Q6Z6W2	9e-33	MAD57_ORYSJ; MADS-box transcription factor 57
TrEMBL	A0A445LXN7	3e-32	A0A445LXN7_GLYSO; MADS-box transcription factor 27
STRING	XP_006466574.1	1e-32	(Citrus sinensis)
STRING	Bo1g003270.1	1e-32	(Brassica oleracea)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM78	28	413

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G14210.1	9e-33	AGAMOUS-like 44

Publications ? help Back to Top
Guo S, et al. The interaction between OsMADS57 and OsTB1 modulates rice tillering via DWARF14. Nat Commun, 2013. 4: p. 1566 [PMID:23463009] Puig J, et al. Analysis of the expression of the AGL17-like clade of MADS-box transcription factors in rice. Gene Expr. Patterns, 2013 Jun-Jul. 13(5-6): p. 160-70 [PMID:23466806] Yu C, et al. The effects of fluctuations in the nutrient supply on the expression of five members of the AGL17 clade of MADS-box genes in rice. PLoS ONE, 2014. 9(8): p. e105597 [PMID:25140876] Wang H, et al. A Signaling Cascade from miR444 to RDR1 in Rice Antiviral RNA Silencing Pathway. Plant Physiol., 2016. 170(4): p. 2365-77 [PMID:26858364]