PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Neem_34010_f_1

Organism

Azadirachta indica

Taxonomic ID

124943

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta

Family

NAC

Protein Properties

Length: 168aa MW: 20310.6 Da PI: 10.2379

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Neem_34010_f_1	genome	NGD	View Nucleic Acid

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	164.8	3.1e-51	3	128	2	128
NAM 2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskk 96 +pGfrFhPt+eelv +yL++kvegk++++ e i+ +d+y+++Pw+Lp+ ++ +ekew+f+++rd+ky++g+r+nr+t+sgyWkatg d+ + s++ Neem_34010_f_1 3 MPGFRFHPTEEELVEFYLRRKVEGKRFNV-ELITFLDLYRYDPWELPALAAIGEKEWFFYVPRDRKYRNGDRPNRVTTSGYWKATGADRMIRSEN 96 79*************************.89***********8778899************************************* PP NAM 97 gelvglkktLvfykgrapkgektdWvmheyrl 128 ++ +glkktLvfy+g+apkg +t+W+m+eyrl Neem_34010_f_1 97 SRSIGLKKTLVFYSGKAPKGIRTSWIMNEYRL 128 ****************************98 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51005	51.915	2	155	IPR003441	NAC domain
SuperFamily	SSF101941	1.1E-53	3	134	IPR003441	NAC domain
Pfam	PF02365	6.5E-26	4	128	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 168 aa Download sequence Send to blast
MVMPGFRFHP TEEELVEFYL RRKVEGKRFN VELITFLDLY RYDPWELPAL AAIGEKEWFF 60 YVPRDRKYRN GDRPNRVTTS GYWKATGADR MIRSENSRSI GLKKTLVFYS GKAPKGIRTS 120 WIMNEYRLPQ HETERYQKFL FTPQHKYMYL RMKISACLWL HTIILLQP

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1ut4_A	1e-53	4	128	19	142	NO APICAL MERISTEM PROTEIN
1ut4_B	1e-53	4	128	19	142	NO APICAL MERISTEM PROTEIN
1ut7_A	1e-53	4	128	19	142	NO APICAL MERISTEM PROTEIN
1ut7_B	1e-53	4	128	19	142	NO APICAL MERISTEM PROTEIN
3swm_A	1e-53	4	128	22	145	NAC domain-containing protein 19
3swm_B	1e-53	4	128	22	145	NAC domain-containing protein 19
3swm_C	1e-53	4	128	22	145	NAC domain-containing protein 19
3swm_D	1e-53	4	128	22	145	NAC domain-containing protein 19
3swp_A	1e-53	4	128	22	145	NAC domain-containing protein 19
3swp_B	1e-53	4	128	22	145	NAC domain-containing protein 19
3swp_C	1e-53	4	128	22	145	NAC domain-containing protein 19
3swp_D	1e-53	4	128	22	145	NAC domain-containing protein 19
4dul_A	1e-53	4	128	19	142	NAC domain-containing protein 19
4dul_B	1e-53	4	128	19	142	NAC domain-containing protein 19
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor that acts as a floral repressor. Controls flowering time by negatively regulating CONSTANS (CO) expression in a GIGANTEA (GI)-independent manner. Regulates the plant cold response by positive regulation of the cold response genes COR15A and KIN1. May coordinate cold response and flowering time. {ECO:0000269\|PubMed:17653269}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Circadian regulation with a peak of expression at dawn under continuous light conditions (PubMed:17653269). Circadian regulation with a peak of expression around dusk and lowest expression around dawn under continuous light conditions (at protein level) (PubMed:17653269). {ECO:0000269\|PubMed:17653269}.

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	JX577909	2e-59	JX577909.1 Gossypium hirsutum clone NBRI_GE9819 microsatellite sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_002519375.1	4e-99	NAC domain-containing protein 35
Refseq	XP_012078844.1	3e-99	NAC domain-containing protein 35-like
Swissprot	Q9ZVP8	2e-94	NAC35_ARATH; NAC domain-containing protein 35
TrEMBL	R4N5L6	7e-98	R4N5L6_JATCU; NAC transcription factor 036
STRING	XP_002519375.1	2e-98	(Ricinus communis)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM5436	27	50

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G02450.2	1e-96	NAC domain containing protein 35

Publications ? help Back to Top
Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Okajima K Molecular mechanism of phototropin light signaling. J. Plant Res., 2016. 129(2): p. 149-57 [PMID:26815763] Nakasone Y,Ohshima M,Okajima K,Tokutomi S,Terazima M Photoreaction Dynamics of LOV1 and LOV2 of Phototropin from Chlamydomonas reinhardtii. J Phys Chem B, 2018. 122(6): p. 1801-1815 [PMID:29355019]