![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Neem_34052_f_1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
|
||||||||
| Family | bHLH | ||||||||
| Protein Properties | Length: 91aa MW: 10329.6 Da PI: 9.3634 | ||||||||
| Description | bHLH family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | HLH | 33.7 | 6.7e-11 | 19 | 59 | 14 | 54 |
HHHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHH CS
HLH 14 driNsafeeLrellPkaskapskKlsKaeiLekAveYIksL 54
d+iN+ ++L++llP++ +++s K+s a +L+++++YI+sL
Neem_34052_f_1 19 DQINDLVSKLQQLLPELRNNRSDKVSAAKVLQETCNYIRSL 59
79**************889********************99 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:4.10.280.10 | 2.2E-10 | 4 | 78 | IPR011598 | Myc-type, basic helix-loop-helix (bHLH) domain |
| PROSITE profile | PS50888 | 12.29 | 5 | 59 | IPR011598 | Myc-type, basic helix-loop-helix (bHLH) domain |
| Pfam | PF00010 | 2.7E-8 | 19 | 59 | IPR011598 | Myc-type, basic helix-loop-helix (bHLH) domain |
| SuperFamily | SSF47459 | 4.84E-11 | 19 | 77 | IPR011598 | Myc-type, basic helix-loop-helix (bHLH) domain |
| CDD | cd00083 | 6.91E-5 | 19 | 63 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0009640 | Biological Process | photomorphogenesis | ||||
| GO:0048510 | Biological Process | regulation of timing of transition from vegetative to reproductive phase | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 91 aa Download sequence Send to blast |
MSSRRSRSRQ SGSSRITDDQ INDLVSKLQQ LLPELRNNRS DKVSAAKVLQ ETCNYIRSLH 60 REVDDLSERL SELLATTDTA QAAIIRSLLM Q |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Atypical and probable non DNA-binding bHLH transcription factor that integrates multiple signaling pathways to regulate cell elongation and plant development. Regulates light responses by binding and inhibiting the activity of the bHLH transcription factor HFR1, a critical regulator of light signaling and shade avoidance. May have a regulatory role in various aspects of gibberellin-dependent growth and development. {ECO:0000269|PubMed:16527868, ECO:0000269|PubMed:20305124}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Not induced by exogenous gibberellin. {ECO:0000269|PubMed:16527868}. | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_006439625.1 | 3e-57 | transcription factor PRE6 | ||||
| Refseq | XP_006476632.1 | 3e-57 | transcription factor PRE6 | ||||
| Swissprot | F4JCN9 | 2e-41 | PRE4_ARATH; Transcription factor PRE4 | ||||
| TrEMBL | A0A067GBS6 | 7e-56 | A0A067GBS6_CITSI; Uncharacterized protein | ||||
| TrEMBL | A0A2H5NG18 | 7e-56 | A0A2H5NG18_CITUN; Uncharacterized protein | ||||
| TrEMBL | V4TMG9 | 7e-56 | V4TMG9_9ROSI; Uncharacterized protein | ||||
| STRING | XP_006476632.1 | 1e-56 | (Citrus sinensis) | ||||
| STRING | XP_006439625.1 | 1e-56 | (Citrus clementina) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM259 | 28 | 225 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G74500.1 | 1e-39 | activation-tagged BRI1(brassinosteroid-insensitive 1)-suppressor 1 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




