![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Neem_36116_a_1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
|
||||||||
| Family | NAC | ||||||||
| Protein Properties | Length: 80aa MW: 9336.8 Da PI: 6.7875 | ||||||||
| Description | NAC family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NAM | 61.8 | 2.1e-19 | 14 | 60 | 2 | 49 |
NAM 2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk 49
ppGfrFhP+deel+v+yL++k++++++++ +vi+evdiyk++Pw+Lp+
Neem_36116_a_1 14 PPGFRFHPSDEELIVHYLQNKAASRPVPA-SVIAEVDIYKYNPWELPS 60
9***************************9.99**************94 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF101941 | 3.4E-21 | 10 | 62 | IPR003441 | NAC domain |
| PROSITE profile | PS51005 | 21.307 | 13 | 80 | IPR003441 | NAC domain |
| Pfam | PF02365 | 2.9E-8 | 14 | 56 | IPR003441 | NAC domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 80 aa Download sequence Send to blast |
MEIRENNPLR FQFPPGFRFH PSDEELIVHY LQNKAASRPV PASVIAEVDI YKYNPWELPS 60 VCFTSLSLVI MHGYSILFLR |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 3ulx_A | 1e-16 | 11 | 60 | 13 | 62 | Stress-induced transcription factor NAC1 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor of the NAC family associated with the grain protein content (GPC). Accelerates senescence and increases nutrient remobilization from leaves to developing grains. Sequences of 11 European varieties of H.vulgare tested belongs to the same haplotype while the sequence found in H.spontaneum, an ancestor of the cultivated H.vulgare which has a higher GPC, belongs to an other haplotype. {ECO:0000269|PubMed:17124321, ECO:0000269|PubMed:20005003}. | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_021278986.1 | 1e-25 | NAC domain-containing protein 19-like | ||||
| Refseq | XP_021681110.1 | 9e-26 | NAC domain-containing protein 68-like | ||||
| Swissprot | A0SPJ8 | 5e-21 | NAM1_HORVV; NAC transcription factor NAM-1 | ||||
| TrEMBL | A0A1R3KR12 | 1e-23 | A0A1R3KR12_9ROSI; No apical meristem (NAM) protein | ||||
| TrEMBL | A0A218XHG9 | 6e-24 | A0A218XHG9_PUNGR; Uncharacterized protein | ||||
| STRING | EOY33050 | 3e-24 | (Theobroma cacao) | ||||
| STRING | evm.model.supercontig_435.1 | 1e-24 | (Carica papaya) | ||||
| STRING | XP_010043727.1 | 5e-26 | (Eucalyptus grandis) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM7967 | 13 | 40 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G61110.1 | 3e-23 | NAC domain containing protein 25 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




