PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Neem_371_f_4

Organism

Azadirachta indica

Taxonomic ID

124943

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta

Family

M-type_MADS

Protein Properties

Length: 91aa MW: 10143.7 Da PI: 11.2657

Description

M-type_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Neem_371_f_4	genome	NGD	View Nucleic Acid

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	91.9	3.1e-29	34	83	2	51
---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 ri+n++ rqvtfskRrng+lKKA ELS+LCdaev +++fsstgklyeys+ Neem_371_f_4 34 RIDNSTSRQVTFSKRRNGLLKKARELSILCDAEVGLMVFSSTGKLYEYSN 83 8***********************************************95 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00432	4.6E-40	25	84	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS50066	31.581	25	85	IPR002100	Transcription factor, MADS-box
SuperFamily	SSF55455	7.98E-29	25	88	IPR002100	Transcription factor, MADS-box
CDD	cd00265	1.54E-38	26	89	No hit	No description
PROSITE pattern	PS00350	0	27	81	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.1E-29	27	47	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	2.7E-26	34	81	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.1E-29	47	62	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.1E-29	62	83	IPR002100	Transcription factor, MADS-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 91 aa Download sequence Send to blast
MGRSETPRKP VPSTRERVGG TLGDMGRGKI VIRRIDNSTS RQVTFSKRRN GLLKKARELS 60 ILCDAEVGLM VFSSTGKLYE YSNSRLDNLS P

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
5f28_A	1e-20	25	89	1	65	MEF2C
5f28_B	1e-20	25	89	1	65	MEF2C
5f28_C	1e-20	25	89	1	65	MEF2C
5f28_D	1e-20	25	89	1	65	MEF2C
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor.
UniProt	Transcriptional factor that targets the CArG motif 5'-C(A/T)TTAAAAAG-3' in the promoter of D14. Directly suppresses D14 expression to control the outgrowth of axillary buds. {ECO:0000269\|PubMed:23463009}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_007148344.1	5e-34	hypothetical protein PHAVU_006G200400g
Refseq	XP_024034710.1	9e-34	MADS-box transcription factor 27 isoform X3
Swissprot	Q6EP49	3e-32	MAD27_ORYSJ; MADS-box transcription factor 27
Swissprot	Q6Z6W2	3e-32	MAD57_ORYSJ; MADS-box transcription factor 57
TrEMBL	A0A1L5YEI1	8e-33	A0A1L5YEI1_PRUPE; MADS-box protein 12
TrEMBL	A0A438GU85	3e-33	A0A438GU85_VITVI; MADS-box transcription factor ANR1
STRING	VIT_03s0097g00160.t01	2e-33	(Vitis vinifera)
STRING	EOX98615	2e-33	(Theobroma cacao)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM78	28	413

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G14210.1	3e-33	AGAMOUS-like 44

Publications ? help Back to Top
Guo S, et al. The interaction between OsMADS57 and OsTB1 modulates rice tillering via DWARF14. Nat Commun, 2013. 4: p. 1566 [PMID:23463009] Puig J, et al. Analysis of the expression of the AGL17-like clade of MADS-box transcription factors in rice. Gene Expr. Patterns, 2013 Jun-Jul. 13(5-6): p. 160-70 [PMID:23466806] Yu C, et al. The effects of fluctuations in the nutrient supply on the expression of five members of the AGL17 clade of MADS-box genes in rice. PLoS ONE, 2014. 9(8): p. e105597 [PMID:25140876] Wang H, et al. A Signaling Cascade from miR444 to RDR1 in Rice Antiviral RNA Silencing Pathway. Plant Physiol., 2016. 170(4): p. 2365-77 [PMID:26858364]