PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Neem_37472_f_1

Organism

Azadirachta indica

Taxonomic ID

124943

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta

Family

MYB_related

Protein Properties

Length: 91aa MW: 10550.5 Da PI: 10.959

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Neem_37472_f_1	genome	NGD	View Nucleic Acid

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	48.5	2.1e-15	8	53	2	48
SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 g W Ede+l+ av ++G+++W++I++ + ++++kqck rw+ +l Neem_37472_f_1 8 GVWKNTEDEILKAAVMKYGKNQWARISSLLV-RKSAKQCKARWYEWL 53 78***************************.**********986 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	22.008	2	57	IPR017930	Myb domain
SuperFamily	SSF46689	2.51E-15	4	59	IPR009057	Homeodomain-like
Gene3D	G3DSA:1.10.10.60	1.2E-18	5	59	IPR009057	Homeodomain-like
SMART	SM00717	7.0E-15	6	55	IPR001005	SANT/Myb domain
Pfam	PF00249	2.4E-13	8	53	IPR001005	SANT/Myb domain
CDD	cd00167	8.78E-12	10	53	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 91 aa Download sequence Send to blast
MRIMIKGGVW KNTEDEILKA AVMKYGKNQW ARISSLLVRK SAKQCKARWY EWLDPSIKKF 60 FCSNNFIPWR KIWAEGGVGS SLMRIVGNLK G

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
5mqf_L	3e-33	2	59	3	60	Cell division cycle 5-like protein
5xjc_L	3e-33	2	59	3	60	Cell division cycle 5-like protein
5yzg_L	3e-33	2	59	3	60	Cell division cycle 5-like protein
5z56_L	3e-33	2	59	3	60	Cell division cycle 5-like protein
5z57_L	3e-33	2	59	3	60	Cell division cycle 5-like protein
5z58_L	3e-33	2	59	3	60	Cell division cycle 5-like protein
6ff4_L	3e-33	2	59	3	60	Cell division cycle 5-like protein
6ff7_L	3e-33	2	59	3	60	Cell division cycle 5-like protein
6icz_L	3e-33	2	59	3	60	Cell division cycle 5-like protein
6id0_L	3e-33	2	59	3	60	Cell division cycle 5-like protein
6id1_L	3e-33	2	59	3	60	Cell division cycle 5-like protein
6qdv_O	3e-33	2	59	3	60	Cell division cycle 5-like protein
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Component of the MAC complex that probably regulates defense responses through transcriptional control and thereby is essential for plant innate immunity. Possesses a sequence specific DNA sequence 'CTCAGCG' binding activity. Involved in mRNA splicing and cell cycle control. May also play a role in the response to DNA damage. {ECO:0000250\|UniProtKB:Q99459, ECO:0000269\|PubMed:17298883, ECO:0000269\|PubMed:17575050, ECO:0000269\|PubMed:8917598}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_001105086.1	2e-35	myb2
Refseq	XP_006589207.1	2e-35	cell division cycle 5-like protein isoform X2
Refseq	XP_010039520.1	2e-35	PREDICTED: cell division cycle 5-like protein isoform X2
Refseq	XP_011648556.1	2e-35	PREDICTED: LOW QUALITY PROTEIN: cell division cycle 5-like protein
Refseq	XP_012461998.1	2e-35	PREDICTED: cell division cycle 5-like protein
Refseq	XP_012842475.1	2e-35	PREDICTED: cell division cycle 5-like protein
Refseq	XP_016455096.1	2e-35	PREDICTED: cell division cycle 5-like protein
Refseq	XP_016673611.1	2e-35	PREDICTED: cell division cycle 5-like protein
Refseq	XP_016725018.1	2e-35	PREDICTED: cell division cycle 5-like protein
Refseq	XP_017619711.1	2e-35	PREDICTED: cell division cycle 5-like protein
Refseq	XP_019418954.1	2e-35	PREDICTED: cell division cycle 5-like protein
Refseq	XP_020223608.1	2e-35	cell division cycle 5-like protein
Refseq	XP_020223609.1	2e-35	cell division cycle 5-like protein
Refseq	XP_020550967.1	2e-35	cell division cycle 5-like protein isoform X2
Refseq	XP_022719074.1	2e-35	cell division cycle 5-like protein
Refseq	XP_022719075.1	2e-35	cell division cycle 5-like protein
Refseq	XP_022719076.1	2e-35	cell division cycle 5-like protein
Refseq	XP_028182163.1	2e-35	cell division cycle 5-like protein isoform X2
Refseq	XP_028182164.1	2e-35	cell division cycle 5-like protein isoform X2
Refseq	XP_029128683.1	2e-35	cell division cycle 5-like protein
Swissprot	P92948	6e-36	CDC5L_ARATH; Cell division cycle 5-like protein
TrEMBL	A0A2I0W418	1e-34	A0A2I0W418_9ASPA; Cell division cycle 5-like protein
STRING	BRADI4G07110.1	7e-35	(Brachypodium distachyon)
STRING	Gorai.013G187200.1	7e-35	(Gossypium raimondii)
STRING	XP_004494735.1	7e-35	(Cicer arietinum)
STRING	GLYMA10G30870.1	7e-35	(Glycine max)
STRING	GLYMA20G36600.2	7e-35	(Glycine max)
STRING	Pavir.Ga02351.1.p	7e-35	(Panicum virgatum)
STRING	XP_007144020.1	7e-35	(Phaseolus vulgaris)
STRING	XP_007151972.1	7e-35	(Phaseolus vulgaris)
STRING	Lus10034133	7e-35	(Linum usitatissimum)
STRING	PGSC0003DMT400029953	7e-35	(Solanum tuberosum)
STRING	Migut.F01544.1.p	7e-35	(Erythranthe guttata)
STRING	OB04G16480.1	7e-35	(Oryza brachyantha)
STRING	Si009268m	7e-35	(Setaria italica)
STRING	Si021096m	7e-35	(Setaria italica)
STRING	Sb08g015280.1	7e-35	(Sorghum bicolor)
STRING	AC203535.4_FGP001	7e-35	(Zea mays)
STRING	XP_004302089.1	7e-35	(Fragaria vesca)
STRING	XP_010039513.1	7e-35	(Eucalyptus grandis)
STRING	LPERR04G05540.2	7e-35	(Leersia perrieri)
STRING	XP_010102234.1	7e-35	(Morus notabilis)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM16532	9	13

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G09770.1	3e-38	cell division cycle 5

Publications ? help Back to Top
Heyndrickx KS,Vandepoele K Systematic identification of functional plant modules through the integration of complementary data sources. Plant Physiol., 2012. 159(3): p. 884-901 [PMID:22589469] Li S, et al. MAC3A and MAC3B, Two Core Subunits of the MOS4-Associated Complex, Positively Influence miRNA Biogenesis. Plant Cell, 2018. 30(2): p. 481-494 [PMID:29437988]