![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Neem_3753_f_2 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
|
||||||||
| Family | MIKC_MADS | ||||||||
| Protein Properties | Length: 114aa MW: 13287.4 Da PI: 10.4738 | ||||||||
| Description | MIKC_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 73.9 | 1.3e-23 | 10 | 59 | 2 | 51 |
---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
SRF-TF 2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
rien snr+vt+skRrng++KKA+E+ vL da+v+++i +s+gk++ey+s
Neem_3753_f_2 10 RIENLSNRKVTYSKRRNGLIKKAKEIAVLYDAKVSLMIHASSGKMHEYCS 59
8***********************************************96 PP
| |||||||
| 2 | K-box | 39.3 | 2.8e-14 | 69 | 114 | 1 | 46 |
K-box 1 yqkssgksleeakaeslqqelakLkkeienLqreqRhllGedLesL 46
y+k+sgk+l++ak+e l++e++++k++++++q ++Rhl+Ged++ L
Neem_3753_f_2 69 YHKQSGKKLWDAKHEDLSNEIERIKRKNDSMQIKLRHLKGEDISHL 114
899****************************************986 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00432 | 2.0E-32 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
| PROSITE profile | PS50066 | 28.09 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
| CDD | cd00265 | 2.02E-32 | 2 | 78 | No hit | No description |
| SuperFamily | SSF55455 | 4.58E-32 | 2 | 93 | IPR002100 | Transcription factor, MADS-box |
| PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 3.5E-24 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 8.1E-19 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 3.5E-24 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 3.5E-24 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF01486 | 2.8E-6 | 80 | 114 | IPR002487 | Transcription factor, K-box |
| PROSITE profile | PS51297 | 8.226 | 82 | 114 | IPR002487 | Transcription factor, K-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 114 aa Download sequence Send to blast |
MGRGKIEIRR IENLSNRKVT YSKRRNGLIK KAKEIAVLYD AKVSLMIHAS SGKMHEYCSS 60 NLVEILDSYH KQSGKKLWDA KHEDLSNEIE RIKRKNDSMQ IKLRHLKGED ISHL |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 6bz1_A | 3e-16 | 1 | 95 | 1 | 91 | MEF2 CHIMERA |
| 6bz1_B | 3e-16 | 1 | 95 | 1 | 91 | MEF2 CHIMERA |
| 6bz1_C | 3e-16 | 1 | 95 | 1 | 91 | MEF2 CHIMERA |
| 6bz1_D | 3e-16 | 1 | 95 | 1 | 91 | MEF2 CHIMERA |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor that may play role in specifying stamen and petal organ identity. {ECO:0000269|PubMed:23181568, ECO:0000269|Ref.1, ECO:0000305|PubMed:17920788}. | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_006434290.1 | 9e-61 | floral homeotic protein FBP1 isoform X1 | ||||
| Refseq | XP_006472853.1 | 9e-61 | floral homeotic protein GLOBOSA isoform X1 | ||||
| Refseq | XP_024040054.1 | 7e-61 | floral homeotic protein GLOBOSA isoform X2 | ||||
| Refseq | XP_024951790.1 | 6e-61 | floral homeotic protein GLOBOSA isoform X2 | ||||
| Swissprot | Q0HA25 | 3e-59 | MADS9_VITVI; Agamous-like MADS-box protein MADS9 | ||||
| TrEMBL | A0A067GP56 | 2e-59 | A0A067GP56_CITSI; Uncharacterized protein | ||||
| TrEMBL | A0A2H5PI91 | 2e-60 | A0A2H5PI91_CITUN; Uncharacterized protein | ||||
| TrEMBL | V4T7S6 | 2e-59 | V4T7S6_9ROSI; Uncharacterized protein | ||||
| STRING | XP_006472853.1 | 3e-60 | (Citrus sinensis) | ||||
| STRING | XP_006434290.1 | 4e-60 | (Citrus clementina) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM5300 | 27 | 51 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G20240.1 | 5e-55 | MIKC_MADS family protein | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




