PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Neem_39730_f_1

Organism

Azadirachta indica

Taxonomic ID

124943

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta

Family

MYB_related

Protein Properties

Length: 80aa MW: 9241.84 Da PI: 11.1761

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Neem_39730_f_1	genome	NGD	View Nucleic Acid

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	34.3	5.5e-11	48	79	1	32
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmg 32 +g+WT+eEd++lv ++++G g+W++ ++ g Neem_39730_f_1 48 KGPWTPEEDQILVSFIQRYGHGNWRALPKQAG 79 79************************999887 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.60	8.4E-14	39	77	IPR009057	Homeodomain-like
SuperFamily	SSF46689	8.28E-10	42	78	IPR009057	Homeodomain-like
PROSITE profile	PS51294	15.405	43	80	IPR017930	Myb domain
Pfam	PF00249	3.1E-9	48	79	IPR001005	SANT/Myb domain
CDD	cd00167	1.67E-6	50	80	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 80 aa Download sequence Send to blast
MKDRKSLPPV LKKAREGERE ILLRNKRISE IGRTMARAPC CQRMGLKKGP WTPEEDQILV 60 SFIQRYGHGN WRALPKQAGN

Functional Description ? help Back to Top
Source	Description
UniProt	Transcriptional activator involved in cold stress response (PubMed:14675437, PubMed:20807373, PubMed:22246661). Regulates positively the expression of genes involved in reactive oxygen species (ROS) scavenging such as peroxidase and superoxide dismutase during cold stress. Transactivates a complex gene network that have major effects on stress tolerance and panicle development (PubMed:20807373). {ECO:0000269\|PubMed:14675437, ECO:0000269\|PubMed:20807373, ECO:0000269\|PubMed:22246661}.
UniProt	Transcription factor involved in cold-regulation of CBF genes and in the development of freezing tolerance. May be part of a complex network of transcription factors controlling the expression of CBF genes and other genes in response to cold stress. Binds to the MYB recognition sequences in the promoters of CBF1, CBF2 and CBF3 genes (PubMed:17015446). Involved in drought and salt tolerance. May enhance expression levels of genes involved in abscisic acid (ABA) biosynthesis and signaling, as well as those encoding stress-protective proteins (PubMed:19161942). {ECO:0000269\|PubMed:17015446, ECO:0000269\|PubMed:19161942}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By cold stress. {ECO:0000269\|PubMed:14675437, ECO:0000269\|PubMed:20807373, ECO:0000269\|Ref.2}.
UniProt	INDUCTION: Induced by abscisic acid (ABA) and drought stress (PubMed:19161942). Induced by salt stress (PubMed:19161942). {ECO:0000269\|PubMed:19161942}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_006442693.1	2e-24	transcription factor MYB4
Refseq	XP_008224356.1	2e-24	PREDICTED: myb-related protein Myb4-like
Refseq	XP_028780706.1	3e-24	transcription factor MYB4-like
Swissprot	Q7XBH4	9e-23	MYB4_ORYSJ; Transcription factor MYB4
Swissprot	Q9LTC4	1e-22	MYB15_ARATH; Transcription factor MYB15
TrEMBL	A0A2H5PZY0	1e-23	A0A2H5PZY0_CITUN; Uncharacterized protein
TrEMBL	A0A2P5FLN0	3e-23	A0A2P5FLN0_TREOI; MYB transcription factor
STRING	XP_008224356.1	9e-24	(Prunus mume)
STRING	XP_006442693.1	8e-24	(Citrus clementina)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM22806	3	3

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G23250.1	6e-25	myb domain protein 15

Publications ? help Back to Top
Park MR, et al. Supra-optimal expression of the cold-regulated OsMyb4 transcription factor in transgenic rice changes the complexity of transcriptional network with major effects on stress tolerance and panicle development. Plant Cell Environ., 2010. 33(12): p. 2209-30 [PMID:20807373] Soltész A, et al. The rice Osmyb4 gene enhances tolerance to frost and improves germination under unfavourable conditions in transgenic barley plants. J. Appl. Genet., 2012. 53(2): p. 133-43 [PMID:22246661] Schnaubelt D, et al. Low glutathione regulates gene expression and the redox potentials of the nucleus and cytosol in Arabidopsis thaliana. Plant Cell Environ., 2015. 38(2): p. 266-79 [PMID:24329757] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Ma X, et al. CYCLIN-DEPENDENT KINASE G2 regulates salinity stress response and salt mediated flowering in Arabidopsis thaliana. Plant Mol. Biol., 2015. 88(3): p. 287-99 [PMID:25948280] Kim SH, et al. Phosphorylation of the transcriptional repressor MYB15 by mitogen-activated protein kinase 6 is required for freezing tolerance in Arabidopsis. Nucleic Acids Res., 2017. 45(11): p. 6613-6627 [PMID:28510716] Chezem WR,Memon A,Li FS,Weng JK,Clay NK SG2-Type R2R3-MYB Transcription Factor MYB15 Controls Defense-Induced Lignification and Basal Immunity in Arabidopsis. Plant Cell, 2017. 29(8): p. 1907-1926 [PMID:28733420] Pal S, et al. TransDetect Identifies a New Regulatory Module Controlling Phosphate Accumulation. Plant Physiol., 2017. 175(2): p. 916-926 [PMID:28827455]