PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Neem_40298_f_1

Organism

Azadirachta indica

Taxonomic ID

124943

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta

Family

WRKY

Protein Properties

Length: 104aa MW: 11985.4 Da PI: 8.6939

Description

WRKY family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Neem_40298_f_1	genome	NGD	View Nucleic Acid

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	WRKY	110	1.1e-34	22	80	1	59
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 l+Dg++WrKYGqK+vkg+++prsYYrCt +C+v+k+ver+++dp+++++tYeg+Hnhe Neem_40298_f_1 22 LNDGFRWRKYGQKVVKGNPYPRSYYRCTNLKCKVRKHVERASDDPTAFITTYEGKHNHE 80 58********************************************************8 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:2.20.25.80	9.8E-37	7	82	IPR003657	WRKY domain
SuperFamily	SSF118290	3.53E-30	16	82	IPR003657	WRKY domain
PROSITE profile	PS50811	34.429	17	82	IPR003657	WRKY domain
SMART	SM00774	1.1E-39	22	81	IPR003657	WRKY domain
Pfam	PF03106	9.9E-28	23	80	IPR003657	WRKY domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 104 aa Download sequence Send to blast
MSEEAMQEPR VVVQSSTDSE ILNDGFRWRK YGQKVVKGNP YPRSYYRCTN LKCKVRKHVE 60 RASDDPTAFI TTYEGKHNHE MPLRNTNPLT SEHDSLAPTS SDKP

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1wj2_A	1e-35	13	82	8	77	Probable WRKY transcription factor 4
2lex_A	1e-35	13	82	8	77	Probable WRKY transcription factor 4
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). Functions with WRKY25 and WRKY33 as positive regulator of plant thermotolerance by partially participating in ethylene-response signal transduction pathway (PubMed:21336597). {ECO:0000250\|UniProtKB:Q9SI37, ECO:0000269\|PubMed:21336597}.
UniProt	Transcription factor that binds specifically to the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element. Has a positive role in resistance to necrotrophic pathogens (e.g. Botrytis cinerea), but a negative effect on plant resistance to biotrophic pathogens (e.g. Pseudomonas syringae). {ECO:0000269\|PubMed:18570649, ECO:0000269\|PubMed:22219184}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By biotic and abiotic stresses such as pathogen infection (e.g. Botrytis cinerea and Pseudomonas syringae), salicylic acid (SA), jasmonic acid (JA), ethylene (ACC), liquid infiltration or spraying, and strongly during leaf senescence. {ECO:0000269\|PubMed:11449049, ECO:0000269\|PubMed:11722756, ECO:0000269\|PubMed:18570649}.
UniProt	INDUCTION: By salicylic acid (PubMed:11449049). Induced by heat stress (PubMed:21336597). {ECO:0000269\|PubMed:11449049, ECO:0000269\|PubMed:21336597}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_006428919.1	2e-58	WRKY transcription factor 44 isoform X1
Refseq	XP_006480560.1	2e-58	WRKY transcription factor 44 isoform X1
Refseq	XP_006480562.1	2e-58	WRKY transcription factor 44 isoform X2
Refseq	XP_024038132.1	2e-58	WRKY transcription factor 44 isoform X1
Refseq	XP_024038133.1	2e-58	WRKY transcription factor 44 isoform X1
Refseq	XP_024038134.1	2e-58	WRKY transcription factor 44 isoform X2
Refseq	XP_024955698.1	2e-58	WRKY transcription factor 44 isoform X1
Refseq	XP_024955699.1	2e-58	WRKY transcription factor 44 isoform X1
Refseq	XP_024955700.1	2e-58	WRKY transcription factor 44 isoform X1
Swissprot	Q9C5T3	2e-36	WRK26_ARATH; Probable WRKY transcription factor 26
Swissprot	Q9XI90	3e-36	WRKY4_ARATH; Probable WRKY transcription factor 4
TrEMBL	A0A411PZL3	5e-57	A0A411PZL3_9ROSI; WRKY family transcription factor
TrEMBL	A0A411PZL4	4e-57	A0A411PZL4_9ROSI; WRKY family transcription factor
TrEMBL	V4URL8	4e-57	V4URL8_9ROSI; Uncharacterized protein
STRING	XP_006480560.1	7e-58	(Citrus sinensis)
STRING	XP_006428919.1	7e-58	(Citrus clementina)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM8362	27	40

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G07100.2	1e-39	WRKY DNA-binding protein 26

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Aamir M, et al. Structural and Functional Insights into WRKY3 and WRKY4 Transcription Factors to Unravel the WRKY-DNA (W-Box) Complex Interaction in Tomato (Solanum lycopersicum L.). A Computational Approach. Front Plant Sci, 2017. 8: p. 819 [PMID:28611792]