![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Neem_6074_f_1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
|
||||||||
| Family | NF-YB | ||||||||
| Protein Properties | Length: 73aa MW: 7770.57 Da PI: 4.9692 | ||||||||
| Description | NF-YB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YB | 87.8 | 1.1e-27 | 23 | 69 | 2 | 48 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvts 48
reqdrflPianvsrimkk+lPanakiskdaketvqecvsefisf+t+
Neem_6074_f_1 23 REQDRFLPIANVSRIMKKALPANAKISKDAKETVQECVSEFISFITG 69
8********************************************97 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF47113 | 2.1E-18 | 11 | 70 | IPR009072 | Histone-fold |
| Gene3D | G3DSA:1.10.20.10 | 2.1E-25 | 17 | 69 | IPR009072 | Histone-fold |
| Pfam | PF00808 | 7.9E-17 | 28 | 69 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 73 aa Download sequence Send to blast |
MADSDNDSGG HNNSNANSEL SAREQDRFLP IANVSRIMKK ALPANAKISK DAKETVQECV 60 SEFISFITGG SVG |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5g49_A | 4e-24 | 18 | 69 | 2 | 53 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT B-6 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_010657477.1 | 5e-44 | PREDICTED: nuclear transcription factor Y subunit B-3 | ||||
| Swissprot | O23310 | 8e-35 | NFYB3_ARATH; Nuclear transcription factor Y subunit B-3 | ||||
| TrEMBL | A0A438DQ89 | 1e-42 | A0A438DQ89_VITVI; Nuclear transcription factor Y subunit B-3 | ||||
| STRING | XP_006469452.1 | 3e-42 | (Citrus sinensis) | ||||
| STRING | VIT_12s0057g01010.t01 | 1e-41 | (Vitis vinifera) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM26062 | 3 | 3 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G14540.1 | 3e-30 | nuclear factor Y, subunit B3 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




