![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Neem_8476_f_1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
|
||||||||
| Family | NAC | ||||||||
| Protein Properties | Length: 60aa MW: 7059.09 Da PI: 3.9798 | ||||||||
| Description | NAC family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NAM | 37.6 | 6.7e-12 | 9 | 54 | 3 | 50 |
NAM 3 pGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkk 50
+GfrF+Ptdee++ Lk k + ++++ ++ike++ y+++Pw+Lp++
Neem_8476_f_1 9 VGFRFKPTDEEII-LLLKMKGLDPDFSV-QTIKEIEFYNFDPWELPSR 54
7************.66777777777888.77**************954 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51005 | 13.205 | 7 | 60 | IPR003441 | NAC domain |
| SuperFamily | SSF101941 | 5.89E-12 | 7 | 57 | IPR003441 | NAC domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 60 aa Download sequence Send to blast |
MEMETDSLVG FRFKPTDEEI ILLLKMKGLD PDFSVQTIKE IEFYNFDPWE LPSRIFGDSV |
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_006465074.1 | 3e-20 | NAC domain-containing protein 60-like | ||||
| Refseq | XP_015382149.1 | 1e-20 | NAC domain-containing protein 40-like, partial | ||||
| Refseq | XP_024038729.1 | 3e-20 | NAC domain-containing protein 60-like | ||||
| TrEMBL | A0A1S8AC39 | 7e-20 | A0A1S8AC39_CITLI; NAC domain containing protein (Fragment) | ||||
| STRING | XP_006465074.1 | 1e-19 | (Citrus sinensis) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM13336 | 4 | 29 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G15500.1 | 6e-13 | NAC domain containing protein 3 | ||||




