![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Neem_9206_f_4 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
|
||||||||
| Family | MIKC_MADS | ||||||||
| Protein Properties | Length: 142aa MW: 16258.9 Da PI: 10.5221 | ||||||||
| Description | MIKC_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 92.6 | 1.8e-29 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
krien rqvtfskRrng+lKKA+ELSvLCda+v vi+fsstgklye+ss
Neem_9206_f_4 9 KRIENLNSRQVTFSKRRNGLLKKAKELSVLCDADVGVIVFSSTGKLYEFSS 59
79***********************************************96 PP
| |||||||
| 2 | K-box | 52.8 | 1.7e-18 | 59 | 122 | 34 | 97 |
K-box 34 eqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkk 97
+ R++ G++L+ L +keLqqLe++L +++ ++++kK+++lleq+++++ e+++ en++Lrk+
Neem_9206_f_4 59 SSRRMNGKELDGLCFKELQQLENRLSEGIFSVKDKKEQVLLEQLKRSRLLEQKAVLENETLRKQ 122
56************************************************************98 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00432 | 6.3E-43 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
| PROSITE profile | PS50066 | 32.688 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
| SuperFamily | SSF55455 | 4.97E-30 | 2 | 64 | IPR002100 | Transcription factor, MADS-box |
| CDD | cd00265 | 1.25E-37 | 2 | 60 | No hit | No description |
| PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 3.1E-30 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 7.0E-27 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
| PROSITE profile | PS51297 | 7.346 | 12 | 133 | IPR002487 | Transcription factor, K-box |
| PRINTS | PR00404 | 3.1E-30 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 3.1E-30 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF01486 | 1.2E-11 | 59 | 122 | IPR002487 | Transcription factor, K-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 142 aa Download sequence Send to blast |
MGRGKIEIKR IENLNSRQVT FSKRRNGLLK KAKELSVLCD ADVGVIVFSS TGKLYEFSSS 60 RRMNGKELDG LCFKELQQLE NRLSEGIFSV KDKKEQVLLE QLKRSRLLEQ KAVLENETLR 120 KQAIIRCSPP QAESAQVRVH LQ |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5f28_A | 2e-18 | 1 | 60 | 1 | 60 | MEF2C |
| 5f28_B | 2e-18 | 1 | 60 | 1 | 60 | MEF2C |
| 5f28_C | 2e-18 | 1 | 60 | 1 | 60 | MEF2C |
| 5f28_D | 2e-18 | 1 | 60 | 1 | 60 | MEF2C |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor involved in the negative regulation of flowering, probably through the photoperiodic pathway. Acts as both an activator and a repressor of transcription. Binds DNA in a sequence-specific manner in large CArG motif 5'-CC (A/T)8 GG-3'. Participates probably in the regulation of programs active during the early stages of embryo development. Prevents premature perianth senescence and abscission, fruits development and seed desiccation. Stimulates the expression of at least DTA4, LEC2, FUS3, ABI3, AT4G38680/CSP2 and GRP2B/CSP4. Can enhance somatic embryo development in vitro. {ECO:0000269|PubMed:10318690, ECO:0000269|PubMed:10662856, ECO:0000269|PubMed:12226488, ECO:0000269|PubMed:12743119, ECO:0000269|PubMed:14615187, ECO:0000269|PubMed:15084721, ECO:0000269|PubMed:15686521, ECO:0000269|PubMed:17521410, ECO:0000269|PubMed:18305206, ECO:0000269|PubMed:19269998, ECO:0000269|PubMed:19767455, ECO:0000269|PubMed:8953767}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: By auxin (2,4-D). Feedback loop leading to direct down-regulation by itself. {ECO:0000269|PubMed:15686521}. | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_024949072.1 | 1e-61 | agamous-like MADS-box protein AGL18 isoform X1 | ||||
| Refseq | XP_024949073.1 | 1e-61 | agamous-like MADS-box protein AGL18 isoform X2 | ||||
| Swissprot | Q38847 | 2e-42 | AGL15_ARATH; Agamous-like MADS-box protein AGL15 | ||||
| TrEMBL | A0A067DSV8 | 8e-60 | A0A067DSV8_CITSI; Uncharacterized protein | ||||
| TrEMBL | A0A2H5QQR1 | 8e-60 | A0A2H5QQR1_CITUN; Uncharacterized protein | ||||
| TrEMBL | M5W7B7 | 6e-60 | M5W7B7_PRUPE; Uncharacterized protein (Fragment) | ||||
| TrEMBL | V4SC55 | 8e-60 | V4SC55_9ROSI; Uncharacterized protein | ||||
| STRING | XP_006492965.1 | 5e-61 | (Citrus sinensis) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM78 | 28 | 413 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G13790.1 | 9e-45 | AGAMOUS-like 15 | ||||




