![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Niben101Ctg15574g00001.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
|
||||||||
| Family | ZF-HD | ||||||||
| Protein Properties | Length: 95aa MW: 10352.4 Da PI: 8.2167 | ||||||||
| Description | ZF-HD family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | ZF-HD_dimer | 104.4 | 7.1e-33 | 21 | 77 | 3 | 59 |
ZF-HD_dimer 3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrevee 59
+vrYkeC+kNhAa++Gg+avDGC+E+mp +geegt +a+ CaACgCHRnFHRr+v+e
Niben101Ctg15574g00001.1 21 SVRYKECQKNHAARVGGYAVDGCREYMPISGEEGTNSAFACAACGCHRNFHRRQVVE 77
69***************************************************9875 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| ProDom | PD125774 | 1.0E-20 | 1 | 80 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
| Pfam | PF04770 | 3.0E-29 | 22 | 75 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
| TIGRFAMs | TIGR01566 | 5.7E-27 | 23 | 74 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
| PROSITE profile | PS51523 | 23.781 | 24 | 74 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 95 aa Download sequence Send to blast |
MKKLQLFLKR EDSSTNSANI SVRYKECQKN HAARVGGYAV DGCREYMPIS GEEGTNSAFA 60 CAACGCHRNF HRRQVVETEV ASDSSSSPSS SSTNN |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Inhibits zinc finger homeodomain (ZHD) transcription factors by interacting with them to prevent both their nuclear localization and their DNA-binding properties. Involved in integrating signals from multiple hormones by regulating the expression of specific genes. {ECO:0000269|PubMed:21455630}. | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_009621029.2 | 1e-53 | PREDICTED: mini zinc finger protein 2-like | ||||
| Refseq | XP_016432582.1 | 1e-53 | PREDICTED: mini zinc finger protein 2-like | ||||
| Swissprot | Q9LJW5 | 9e-31 | MIF2_ARATH; Mini zinc finger protein 2 | ||||
| TrEMBL | A0A314L3S5 | 4e-53 | A0A314L3S5_NICAT; Mini zinc finger protein 2 | ||||
| STRING | XP_009621029.1 | 5e-53 | (Nicotiana tomentosiformis) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Asterids | OGEA1105 | 24 | 86 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G28917.1 | 4e-29 | mini zinc finger 2 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




