PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Niben101Scf00048g00003.1

Organism

Nicotiana benthamiana

Taxonomic ID

4100

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana

Family

NAC

Protein Properties

Length: 92aa MW: 10230.3 Da PI: 4.3017

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Niben101Scf00048g00003.1	genome	BTI	-

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	55.2	2.4e-17	33	80	1	49
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk 49 + pGfrF+Ptdeelv++yLkkk+eg++ + evi+ev+i k+ePwdLp Niben101Scf00048g00003.1 33 MFPGFRFSPTDEELVSYYLKKKLEGSDRCV-EVISEVEIWKHEPWDLPG 80 579**********************777.99************93 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF101941	1.28E-17	29	82	IPR003441	NAC domain
PROSITE profile	PS51005	19.02	33	92	IPR003441	NAC domain
Pfam	PF02365	5.8E-8	35	76	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 92 aa Download sequence Send to blast
IMEDGHVSGS RNENGTTPRN NNVEISIATA SSMFPGFRFS PTDEELVSYY LKKKLEGSDR 60 CVEVISEVEI WKHEPWDLPG RDGDMGVDGG LQ

Functional Description ? help Back to Top
Source	Description
UniProt	Transcriptional activator activated by proteolytic cleavage through regulated intramembrane proteolysis (RIP), probably via metalloprotease activity. Regulates gibberellic acid-mediated salt-responsive repression of seed germination and flowering via FT, thus delaying seed germination under high salinity conditions. {ECO:0000269\|PubMed:17410378, ECO:0000269\|PubMed:18363782, ECO:0000269\|PubMed:19704528, ECO:0000269\|PubMed:19704545}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By high salt stress (PubMed:19704545, PubMed:17410378, PubMed:18363782, PubMed:19704528). Repressed by gibberellic acid (GA), but induced by the GA biosynthetic inhibitor paclabutrazol (PAC) (PubMed:18363782). Accumulates transiently in seeds upon imbibition (PubMed:19704545, PubMed:17410378, PubMed:18363782, PubMed:19704528). Induced by drought stress (PubMed:17158162). {ECO:0000269\|PubMed:17158162, ECO:0000269\|PubMed:17410378, ECO:0000269\|PubMed:18363782, ECO:0000269\|PubMed:19704528, ECO:0000269\|PubMed:19704545}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_019232292.1	2e-49	PREDICTED: NAC domain-containing protein 89-like
Swissprot	Q9XIN7	4e-19	NAC40_ARATH; NAC domain-containing protein 40
TrEMBL	A0A1B1FBP7	9e-49	A0A1B1FBP7_NICBE; Endoplasmic reticulum transcription factor
STRING	XP_009758643.1	6e-46	(Nicotiana sylvestris)
STRING	XP_009590635.1	4e-46	(Nicotiana tomentosiformis)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA4154	22	43

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G27300.1	2e-21	NTM1-like 8

Publications ? help Back to Top
Liang M, et al. Subcellular Distribution of NTL Transcription Factors in Arabidopsis thaliana. Traffic, 2015. 16(10): p. 1062-74 [PMID:26201836] Tian H, et al. NTL8 Regulates Trichome Formation in Arabidopsis by Directly Activating R3 MYB Genes TRY and TCL1. Plant Physiol., 2017. 174(4): p. 2363-2375 [PMID:28649093]