![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Niben101Scf00557g00003.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
|
||||||||
| Family | HSF | ||||||||
| Protein Properties | Length: 61aa MW: 6957.96 Da PI: 8.5142 | ||||||||
| Description | HSF family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | HSF_DNA-bind | 32.4 | 2.4e-10 | 10 | 53 | 2 | 46 |
HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHST CS
HSF_DNA-bind 2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFk 46
Fl k+y++++d++++++isw ++nsfvv+d+ + L+ +k
Niben101Scf00557g00003.1 10 FLVKTYDMVDDPRTNKIISWGPTNNSFVVWDPPCVRQ-GLTAQWK 53
9********************999*******988777.6666666 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.10.10 | 8.0E-12 | 4 | 48 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
| SuperFamily | SSF46785 | 4.22E-10 | 5 | 44 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
| SMART | SM00415 | 0.0062 | 6 | 60 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| Pfam | PF00447 | 2.0E-7 | 10 | 46 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 61 aa Download sequence Send to blast |
MPRANAPLPF LVKTYDMVDD PRTNKIISWG PTNNSFVVWD PPCVRQGLTA QWKINRADEV 60 S |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | DNA-binding protein that specifically binds heat shock promoter elements (HSE) and activates transcription. {ECO:0000250}. | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_019267090.1 | 6e-19 | PREDICTED: heat shock factor protein HSF8-like | ||||
| Swissprot | Q40152 | 1e-14 | HSF8_SOLLC; Heat shock factor protein HSF8 | ||||
| TrEMBL | A0A314L0P4 | 1e-17 | A0A314L0P4_NICAT; Heat shock factor protein hsf8 | ||||
| STRING | XP_009781208.1 | 3e-18 | (Nicotiana sylvestris) | ||||
| STRING | XP_009600492.1 | 3e-18 | (Nicotiana tomentosiformis) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Asterids | OGEA572 | 24 | 113 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G17750.1 | 4e-16 | heat shock factor 1 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




