![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Niben101Scf01063g02004.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 67aa MW: 7864.96 Da PI: 11.0857 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 55.8 | 1e-17 | 6 | 49 | 1 | 44 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHH CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrw 44
+g+WT+eEd++lvd++++ G g+W++ +++ g++R +k+c++rw
Niben101Scf01063g02004.1 6 KGPWTPEEDQKLVDYIHRNGHGNWRALPKRAGLNRYGKSCRLRW 49
79****************************************** PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51294 | 21.622 | 1 | 57 | IPR017930 | Myb domain |
| SuperFamily | SSF46689 | 9.18E-18 | 3 | 67 | IPR009057 | Homeodomain-like |
| Gene3D | G3DSA:1.10.10.60 | 1.3E-19 | 4 | 48 | IPR009057 | Homeodomain-like |
| SMART | SM00717 | 2.7E-10 | 5 | 55 | IPR001005 | SANT/Myb domain |
| Pfam | PF00249 | 4.3E-16 | 6 | 49 | IPR001005 | SANT/Myb domain |
| CDD | cd00167 | 5.48E-9 | 8 | 49 | No hit | No description |
| Gene3D | G3DSA:1.10.10.60 | 2.8E-7 | 49 | 67 | IPR009057 | Homeodomain-like |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 67 aa Download sequence Send to blast |
MNGLKKGPWT PEEDQKLVDY IHRNGHGNWR ALPKRAGLNR YGKSCRLRWS AIATRLRGRT 60 DNEIKNY |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor that acts as negative regulator of lateral root (LR) development. Required for normal auxin responses during LR development. May be part of a negative feedback loop stimulated specifically in the endodermis upon LR initiation to ensure that LRs are formed only in the correct place. {ECO:0000269|PubMed:24902892}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Induced by abscisic acid (ABA), auxin and gravity in roots. {ECO:0000269|PubMed:24902892}. | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_019259157.1 | 4e-32 | PREDICTED: transcription factor MYB39-like | ||||
| Swissprot | Q9S9Z2 | 7e-30 | MYB93_ARATH; Transcription factor MYB93 | ||||
| TrEMBL | A0A314LEP5 | 1e-30 | A0A314LEP5_NICAT; Transcription factor myb39 | ||||
| STRING | XP_009776410.1 | 8e-31 | (Nicotiana sylvestris) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Asterids | OGEA21622 | 2 | 2 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G34670.1 | 3e-32 | myb domain protein 93 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




