![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Niben101Scf01111g06008.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
|
||||||||
| Family | NF-YC | ||||||||
| Protein Properties | Length: 99aa MW: 10992.4 Da PI: 4.724 | ||||||||
| Description | NF-YC family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YC | 87.4 | 1.4e-27 | 3 | 72 | 31 | 100 |
NF-YC 31 kadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflvdivprde 100
k+ +dvkmis eaP+++skacelfi elt r+w+ + + krrt++k d+a+av tdifdflv+ v +++
Niben101Scf01111g06008.1 3 KSSDDVKMISGEAPIIFSKACELFIEELTKRAWIITMQGKRRTIHKEDVASAVIATDIFDFLVNLVTESD 72
7899************************************************************998875 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Pfam | PF00808 | 5.0E-16 | 1 | 55 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| SuperFamily | SSF47113 | 1.8E-20 | 3 | 69 | IPR009072 | Histone-fold |
| Gene3D | G3DSA:1.10.20.10 | 3.9E-25 | 3 | 68 | IPR009072 | Histone-fold |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 99 aa Download sequence Send to blast |
MKKSSDDVKM ISGEAPIIFS KACELFIEEL TKRAWIITMQ GKRRTIHKED VASAVIATDI 60 FDFLVNLVTE SDVADNKCEV NEFSSHNGGI SEGRGEARD |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5g49_B | 1e-23 | 3 | 68 | 28 | 93 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT C-3 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}. | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_009628926.1 | 8e-52 | PREDICTED: nuclear transcription factor Y subunit C-2-like | ||||
| Refseq | XP_016485723.1 | 8e-52 | PREDICTED: nuclear transcription factor Y subunit C-2-like | ||||
| Refseq | XP_019237199.1 | 8e-52 | PREDICTED: nuclear transcription factor Y subunit C-2-like | ||||
| Swissprot | Q9ZVL3 | 4e-24 | NFYC3_ARATH; Nuclear transcription factor Y subunit C-3 | ||||
| TrEMBL | A0A1J6JZQ0 | 2e-50 | A0A1J6JZQ0_NICAT; Nuclear transcription factor y subunit c-9 | ||||
| TrEMBL | A0A1S4BA97 | 2e-50 | A0A1S4BA97_TOBAC; nuclear transcription factor Y subunit C-2-like | ||||
| STRING | XP_009628926.1 | 3e-51 | (Nicotiana tomentosiformis) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Asterids | OGEA12881 | 17 | 20 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G54830.3 | 1e-26 | nuclear factor Y, subunit C3 | ||||




