PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Niben101Scf01252g01009.1

Organism

Nicotiana benthamiana

Taxonomic ID

4100

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana

Family

M-type_MADS

Protein Properties

Length: 80aa MW: 9270.92 Da PI: 10.8325

Description

M-type_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Niben101Scf01252g01009.1	genome	BTI	-

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	82.5	2.7e-26	11	58	3	50
--SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS SRF-TF 3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50 ie +nrqvtfskRrngilKK +ELSvLCd++va+i+fs++g+l ys Niben101Scf01252g01009.1 11 IERLTNRQVTFSKRRNGILKKIYELSVLCDVDVAIIMFSPSGRLTHYS 58 8899*****************************************998 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00432	1.7E-30	1	60	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS50066	26.562	1	61	IPR002100	Transcription factor, MADS-box
SuperFamily	SSF55455	3.01E-26	2	77	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	2.1E-23	3	23	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	7.6E-25	10	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	2.1E-23	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	2.1E-23	38	59	IPR002100	Transcription factor, MADS-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 80 aa Download sequence Send to blast
MGRSKLPLLK IERLTNRQVT FSKRRNGILK KIYELSVLCD VDVAIIMFSP SGRLTHYSRK 60 RRIEDVLSEL VNLPDSERGL

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
6byy_A	5e-16	1	58	1	58	MEF2 CHIMERA
6byy_B	5e-16	1	58	1	58	MEF2 CHIMERA
6byy_C	5e-16	1	58	1	58	MEF2 CHIMERA
6byy_D	5e-16	1	58	1	58	MEF2 CHIMERA
6bz1_A	6e-16	1	58	1	58	MEF2 CHIMERA
6bz1_B	6e-16	1	58	1	58	MEF2 CHIMERA
6bz1_C	6e-16	1	58	1	58	MEF2 CHIMERA
6bz1_D	6e-16	1	58	1	58	MEF2 CHIMERA
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor that forms heterodimers with the MADS-box proteins AGL30 and AGL65 and is involved in the regulation of pollen maturation at the late stages of pollen development and pollen tube growth. {ECO:0000269\|PubMed:19211705}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_009599349.1	3e-49	PREDICTED: agamous-like MADS-box protein AGL104 isoform X3
Swissprot	Q9LM46	3e-30	AG104_ARATH; Agamous-like MADS-box protein AGL104
TrEMBL	A0A1S3YRG5	4e-47	A0A1S3YRG5_TOBAC; agamous-like MADS-box protein AGL104 isoform X3
STRING	XP_009599347.1	4e-46	(Nicotiana tomentosiformis)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA13070	14	16

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G22130.1	1e-32	AGAMOUS-like 104

Publications ? help Back to Top
Zhang S, et al. FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development. Plant Physiol., 2018. 177(1): p. 285-299 [PMID:29523711]