PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Niben101Scf01327g01022.1

Organism

Nicotiana benthamiana

Taxonomic ID

4100

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana

Family

M-type_MADS

Protein Properties

Length: 66aa MW: 7620.97 Da PI: 11.8331

Description

M-type_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Niben101Scf01327g01022.1	genome	BTI	-

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	87.6	6.9e-28	9	59	1	51
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krie+ s rq tfskRrng++KKA+ LS+LCd++vavi+fss+g+l+e+ss Niben101Scf01327g01022.1 9 KRIEDRSSRQATFSKRRNGLMKKAKQLSILCDVDVAVIVFSSRGRLFEFSS 59 79***********************************************96 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50066	30.389	1	61	IPR002100	Transcription factor, MADS-box
SMART	SM00432	1.1E-36	1	60	IPR002100	Transcription factor, MADS-box
SuperFamily	SSF55455	4.32E-28	2	61	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	9.7E-28	3	23	IPR002100	Transcription factor, MADS-box
PROSITE pattern	PS00350	0	3	57	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	1.1E-26	10	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	9.7E-28	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	9.7E-28	38	59	IPR002100	Transcription factor, MADS-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 66 aa Download sequence Send to blast
MGRKKVEIKR IEDRSSRQAT FSKRRNGLMK KAKQLSILCD VDVAVIVFSS RGRLFEFSST 60 NRIFIA

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1tqe_P	3e-21	1	61	1	61	Myocyte-specific enhancer factor 2B
1tqe_Q	3e-21	1	61	1	61	Myocyte-specific enhancer factor 2B
1tqe_R	3e-21	1	61	1	61	Myocyte-specific enhancer factor 2B
1tqe_S	3e-21	1	61	1	61	Myocyte-specific enhancer factor 2B
6c9l_A	3e-21	1	61	1	61	Myocyte-specific enhancer factor 2B
6c9l_B	3e-21	1	61	1	61	Myocyte-specific enhancer factor 2B
6c9l_C	3e-21	1	61	1	61	Myocyte-specific enhancer factor 2B
6c9l_D	3e-21	1	61	1	61	Myocyte-specific enhancer factor 2B
6c9l_E	3e-21	1	61	1	61	Myocyte-specific enhancer factor 2B
6c9l_F	3e-21	1	61	1	61	Myocyte-specific enhancer factor 2B
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcriptional factor that targets the CArG motif 5'-C(A/T)TTAAAAAG-3' in the promoter of D14. Directly suppresses D14 expression to control the outgrowth of axillary buds. {ECO:0000269\|PubMed:23463009}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_006352169.1	4e-35	PREDICTED: agamous-like MADS-box protein AGL27
Refseq	XP_009790268.1	3e-35	PREDICTED: agamous-like MADS-box protein AGL27
Refseq	XP_010321013.1	4e-35	agamous-like MADS-box protein AGL27
Refseq	XP_010321014.1	4e-35	agamous-like MADS-box protein AGL27
Swissprot	Q6Z6W2	5e-25	MAD57_ORYSJ; MADS-box transcription factor 57
TrEMBL	A0A0V0HPI5	9e-35	A0A0V0HPI5_SOLCH; Putative ovule protein
TrEMBL	A0A0V0HZX3	9e-34	A0A0V0HZX3_SOLCH; Putative agamous-like MADS-box protein AGL27-like
TrEMBL	A0A1U7XHB6	6e-34	A0A1U7XHB6_NICSY; agamous-like MADS-box protein AGL27
STRING	Solyc05g015730.1.1	3e-36	(Solanum lycopersicum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA40	24	625

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G09960.2	3e-27	MIKC_MADS family protein

Publications ? help Back to Top
Guo S, et al. The interaction between OsMADS57 and OsTB1 modulates rice tillering via DWARF14. Nat Commun, 2013. 4: p. 1566 [PMID:23463009] Puig J, et al. Analysis of the expression of the AGL17-like clade of MADS-box transcription factors in rice. Gene Expr. Patterns, 2013 Jun-Jul. 13(5-6): p. 160-70 [PMID:23466806] Yu C, et al. The effects of fluctuations in the nutrient supply on the expression of five members of the AGL17 clade of MADS-box genes in rice. PLoS ONE, 2014. 9(8): p. e105597 [PMID:25140876] Wang H, et al. A Signaling Cascade from miR444 to RDR1 in Rice Antiviral RNA Silencing Pathway. Plant Physiol., 2016. 170(4): p. 2365-77 [PMID:26858364]