PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Niben101Scf01470g00001.1

Organism

Nicotiana benthamiana

Taxonomic ID

4100

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana

Family

HB-other

Protein Properties

Length: 96aa MW: 10968.3 Da PI: 4.9213

Description

HB-other family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Niben101Scf01470g00001.1	genome	BTI	-

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Homeobox	16.2	1.8e-05	64	94	7	37
--HHHHHHHHHHHHHSSS--HHHHHHHHHHC CS Homeobox 7 ftkeqleeLeelFeknrypsaeereeLAkkl 37 + +q+++Le+ Fe ++++ e++ +LA++l Niben101Scf01470g00001.1 64 LRVDQVKALEKNFEVDNKLEPERKVKLAQEL 94 5679*************************98 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.60	3.1E-5	67	95	IPR009057	Homeodomain-like

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 96 aa Download sequence Send to blast
MKRVRSSDSL GVPLMSMCQN TTDDHNQWNS QVYSRDFQSM LELGLADEPC VEESGHGSEK 60 KGRLRVDQVK ALEKNFEVDN KLEPERKVKL AQELDS

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription activator that may act as growth regulators in response to water deficit. Interacts with the core sequence 5'-CAATTATTA-3' of promoters in response to ABA and in an ABI1-dependent manner. Involved in the negative regulation of the ABA signaling pathway. {ECO:0000269\|PubMed:10527431, ECO:0000269\|PubMed:12065416}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By water deficit, by abscisic acid (ABA) and by salt stress. Self expression regulation. {ECO:0000269\|PubMed:10527431, ECO:0000269\|PubMed:12065416, ECO:0000269\|PubMed:16055682}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_009768030.1	3e-58	PREDICTED: homeobox-leucine zipper protein ATHB-6-like
Refseq	XP_016493903.1	3e-58	PREDICTED: homeobox-leucine zipper protein ATHB-6-like
Swissprot	P46668	2e-19	ATHB6_ARATH; Homeobox-leucine zipper protein ATHB-6
TrEMBL	A0A1S4BYI3	6e-57	A0A1S4BYI3_TOBAC; homeobox-leucine zipper protein ATHB-6-like
TrEMBL	A0A1U7W1A4	6e-57	A0A1U7W1A4_NICSY; homeobox-leucine zipper protein ATHB-6-like
STRING	XP_009768030.1	1e-57	(Nicotiana sylvestris)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA2718	24	53

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G22430.1	7e-22	homeobox protein 6

Publications ? help Back to Top
Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Song L, et al. A transcription factor hierarchy defines an environmental stress response network. Science, 2017. [PMID:27811239]