PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Niben101Scf01591g00001.1

Organism

Nicotiana benthamiana

Taxonomic ID

4100

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana

Family

NAC

Protein Properties

Length: 169aa MW: 19485.2 Da PI: 9.8418

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Niben101Scf01591g00001.1	genome	BTI	-

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	77	4.3e-24	5	68	65	128
NAM 65 dkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128 ++k ++g+r+nra+ +gyWkatg dke++++k+ +glkk+Lv+y g+ pkgekt+W+mheyrl Niben101Scf01591g00001.1 5 NTKRSNGNRPNRAAGDGYWKATGADKEIKDNKNVIIGLKKSLVYYIGKPPKGEKTNWIMHEYRL 68 467889**********************9999**************************98 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51005	31.75	1	95	IPR003441	NAC domain
SuperFamily	SSF101941	1.7E-29	4	95	IPR003441	NAC domain
Pfam	PF02365	2.6E-11	11	68	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 169 aa Download sequence Send to blast
MVCLNTKRSN GNRPNRAAGD GYWKATGADK EIKDNKNVII GLKKSLVYYI GKPPKGEKTN 60 WIMHEYRLPD IPNLAERDIN NWKLDEWVLC RIYKKSDRDN TMVTQRKRIR DAYETKAGRG 120 NSNDSDQDFN NDVQIVLVSW KSSPKLIKIN SAKLDDALEA KLFLENLID

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1ut4_A	4e-29	7	95	82	165	NO APICAL MERISTEM PROTEIN
1ut4_B	4e-29	7	95	82	165	NO APICAL MERISTEM PROTEIN
1ut7_A	4e-29	7	95	82	165	NO APICAL MERISTEM PROTEIN
1ut7_B	4e-29	7	95	82	165	NO APICAL MERISTEM PROTEIN
3swm_A	4e-29	7	95	85	168	NAC domain-containing protein 19
3swm_B	4e-29	7	95	85	168	NAC domain-containing protein 19
3swm_C	4e-29	7	95	85	168	NAC domain-containing protein 19
3swm_D	4e-29	7	95	85	168	NAC domain-containing protein 19
3swp_A	4e-29	7	95	85	168	NAC domain-containing protein 19
3swp_B	4e-29	7	95	85	168	NAC domain-containing protein 19
3swp_C	4e-29	7	95	85	168	NAC domain-containing protein 19
3swp_D	4e-29	7	95	85	168	NAC domain-containing protein 19
4dul_A	4e-29	7	95	82	165	NAC domain-containing protein 19
4dul_B	4e-29	7	95	82	165	NAC domain-containing protein 19
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcriptional activator that positively regulates age-dependent senescence, dark-induced leaf senescence and stress-induced senescence. Regulates leaf senescence through the modulation of the expression of senescence-associated genes SGR1/NYE1, SAG113 and SAUR36/SAG201, which are involved in chlorophyll degradation, and abscisic acid (ABA) and auxin promotion of senescence, respectively. Promotes reactive oxygen species (ROS) production during age-dependent and stress-induced senescence. Regulates positively auxin-mediated responses in roots (PubMed:27388337). Stress-responsive NAC transcription factor involved in ABA-inducible leaf senescence signaling (PubMed:26518251). Required for normal seed development and morphology (PubMed:18849494). {ECO:0000269\|PubMed:18849494, ECO:0000269\|PubMed:26518251, ECO:0000269\|PubMed:27388337}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By abscisic acid (ABA) (PubMed:26518251). Induced by salinity and osmotic stress, and during leaf senescence (PubMed:27388337). {ECO:0000269\|PubMed:26518251, ECO:0000269\|PubMed:27388337}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_009793862.1	3e-80	PREDICTED: NAC domain-containing protein 102-like
Refseq	XP_016458645.1	3e-80	PREDICTED: NAC domain-containing protein 102-like
Swissprot	Q9CAR0	7e-32	NAC32_ARATH; NAC transcription factor 32
TrEMBL	A0A1S3Z2J1	7e-79	A0A1S3Z2J1_TOBAC; NAC domain-containing protein 102-like
TrEMBL	A0A1U7XP91	8e-79	A0A1U7XP91_NICSY; NAC domain-containing protein 102-like
STRING	XP_009626689.1	5e-80	(Nicotiana tomentosiformis)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA13936	12	13

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G77450.1	5e-34	NAC domain containing protein 32

Publications ? help Back to Top
Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Vermeirssen V,De Clercq I,Van Parys T,Van Breusegem F,Van de Peer Y Arabidopsis ensemble reverse-engineered gene regulatory network discloses interconnected transcription factors in oxidative stress. Plant Cell, 2014. 26(12): p. 4656-79 [PMID:25549671] Takasaki H, et al. SNAC-As, stress-responsive NAC transcription factors, mediate ABA-inducible leaf senescence. Plant J., 2015. 84(6): p. 1114-23 [PMID:26518251] Mahmood K,El-Kereamy A,Kim SH,Nambara E,Rothstein SJ ANAC032 Positively Regulates Age-Dependent and Stress-Induced Senescence in Arabidopsis thaliana. Plant Cell Physiol., 2016. 57(10): p. 2029-2046 [PMID:27388337] Allu AD,Brotman Y,Xue GP,Balazadeh S Transcription factor ANAC032 modulates JA/SA signalling in response to Pseudomonas syringae infection. EMBO Rep., 2016. 17(11): p. 1578-1589 [PMID:27632992] Mahmood K,Xu Z,El-Kereamy A,Casaretto JA,Rothstein SJ The Arabidopsis Transcription Factor ANAC032 Represses Anthocyanin Biosynthesis in Response to High Sucrose and Oxidative and Abiotic Stresses. Front Plant Sci, 2016. 7: p. 1548 [PMID:27790239] Song L, et al. A transcription factor hierarchy defines an environmental stress response network. Science, 2017. [PMID:27811239]