![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Niben101Scf01974g00010.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
|
||||||||
| Family | NF-YB | ||||||||
| Protein Properties | Length: 131aa MW: 14883.8 Da PI: 6.0911 | ||||||||
| Description | NF-YB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YB | 154.7 | 1.6e-48 | 37 | 129 | 2 | 94 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvy 86
reqdrf+Pianv+rim+k+lP ++kis+daket++ecvsefisf+t+ea+d+cqre+ kt++++d+lwa+++lGf+dy++pl++y
Niben101Scf01974g00010.1 37 REQDRFMPIANVIRIMRKILPPHTKISDDAKETIKECVSEFISFITGEANDRCQREQHKTLTAKDVLWAMSKLGFDDYIQPLTIY 121
89*********************************************************************************** PP
NF-YB 87 lkkyrele 94
l++ e +
Niben101Scf01974g00010.1 122 LHRCHEYD 129
***98876 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.20.10 | 8.9E-46 | 32 | 128 | IPR009072 | Histone-fold |
| SuperFamily | SSF47113 | 5.12E-35 | 39 | 128 | IPR009072 | Histone-fold |
| Pfam | PF00808 | 1.9E-24 | 42 | 106 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| PRINTS | PR00615 | 1.1E-11 | 70 | 88 | No hit | No description |
| PROSITE pattern | PS00685 | 0 | 73 | 89 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
| PRINTS | PR00615 | 1.1E-11 | 89 | 107 | No hit | No description |
| PRINTS | PR00615 | 1.1E-11 | 108 | 126 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 131 aa Download sequence Send to blast |
MGTNLSTQLN QVIPTSNNNN NNNINNVVAA DSECTGREQD RFMPIANVIR IMRKILPPHT 60 KISDDAKETI KECVSEFISF ITGEANDRCQ REQHKTLTAK DVLWAMSKLG FDDYIQPLTI 120 YLHRCHEYDG G |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5g49_A | 2e-56 | 32 | 127 | 2 | 97 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT B-6 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. Plays a role in the regulation of the embryogenesis. Involved in the abscisic acid (ABA) signaling pathway. {ECO:0000269|PubMed:12509518, ECO:0000269|PubMed:17322342}. | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_018629766.1 | 7e-76 | PREDICTED: nuclear transcription factor Y subunit B-4-like | ||||
| Swissprot | Q84W66 | 7e-58 | NFYB6_ARATH; Nuclear transcription factor Y subunit B-6 | ||||
| TrEMBL | A0A1S3XJV1 | 3e-70 | A0A1S3XJV1_TOBAC; nuclear transcription factor Y subunit B-3-like | ||||
| STRING | XP_009613315.1 | 5e-75 | (Nicotiana tomentosiformis) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Asterids | OGEA111 | 24 | 356 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G47670.2 | 5e-60 | nuclear factor Y, subunit B6 | ||||




