PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Niben101Scf02771g03017.1

Organism

Nicotiana benthamiana

Taxonomic ID

4100

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana

Family

Dof

Protein Properties

Length: 116aa MW: 12766.4 Da PI: 9.0234

Description

Dof family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Niben101Scf02771g03017.1	genome	BTI	-

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	zf-Dof	72	8.6e-23	78	116	2	40
zf-Dof 2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryW 40 +e+alkcprC+s+ntkfCy+nnyslsqPr+fCk+Crry+ Niben101Scf02771g03017.1 78 PETALKCPRCESSNTKFCYFNNYSLSQPRHFCKTCRRYY 116 57789*********************************6 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
ProDom	PD007478	2.0E-24	62	116	IPR003851	Zinc finger, Dof-type
Pfam	PF02701	8.7E-19	80	116	IPR003851	Zinc finger, Dof-type
PROSITE profile	PS50884	20.793	82	116	IPR003851	Zinc finger, Dof-type

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 116 aa Download sequence Send to blast
MVFSSIPAYL DPANWQQQSG GSIPNHHQLT SPPSQTATPP PLPPPPPPLQ PHDSTGGAGS 60 IRPGSMADRA RLANIPMPET ALKCPRCESS NTKFCYFNNY SLSQPRHFCK TCRRYY

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence (By similarity). Probably involved in early processes for vascular development (PubMed:17583520). The PEAR proteins (e.g. DOF2.4, DOF5.1, DOF3.2, DOF1.1, DOF5.6 and DOF5.3) activate gene expression that promotes radial growth of protophloem sieve elements. Triggers the transcription of HD-ZIP III genes, especially in the central domain of vascular tissue (PubMed:30626969). {ECO:0000250\|UniProtKB:Q9M2U1, ECO:0000269\|PubMed:17583520, ECO:0000269\|PubMed:30626969}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By cytokinin in procambium. Antagonized by the HD-ZIP III proteins and by mobile miR165 and miR166 microRNAs. {ECO:0000269\|PubMed:30626969}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_019250522.1	3e-65	PREDICTED: dof zinc finger protein DOF2.4-like
Swissprot	O80928	2e-35	DOF24_ARATH; Dof zinc finger protein DOF2.4
TrEMBL	A0A1J6J1N7	6e-64	A0A1J6J1N7_NICAT; Dof zinc finger protein dof2.4
STRING	XP_009758525.1	2e-64	(Nicotiana sylvestris)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA1917	24	63

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G37590.1	7e-35	DNA binding with one finger 2.4

Publications ? help Back to Top
Heyndrickx KS,Vandepoele K Systematic identification of functional plant modules through the integration of complementary data sources. Plant Physiol., 2012. 159(3): p. 884-901 [PMID:22589469] Miyashima S, et al. Mobile PEAR transcription factors integrate positional cues to prime cambial growth. Nature, 2019. 565(7740): p. 490-494 [PMID:30626969]