![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Niben101Scf02849g03003.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
|
||||||||
| Family | LBD | ||||||||
| Protein Properties | Length: 89aa MW: 9903.3 Da PI: 8.201 | ||||||||
| Description | LBD family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | DUF260 | 128.5 | 3e-40 | 7 | 87 | 1 | 81 |
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvil 81
+CaaCk+lrrkC+++Cv+apyfp +qp+kfanvhk+FGasnv kll++l+ ++reda++sl+yeAe r+rdPvyG+vg+i+
Niben101Scf02849g03003.1 7 PCAACKFLRRKCTQECVFAPYFPPDQPQKFANVHKVFGASNVAKLLNELNATQREDAVNSLAYEAEYRLRDPVYGCVGLIS 87
7*****************************************************************************996 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50891 | 24.897 | 6 | 89 | IPR004883 | Lateral organ boundaries, LOB |
| Pfam | PF03195 | 4.9E-40 | 7 | 87 | IPR004883 | Lateral organ boundaries, LOB |
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 89 aa Download sequence Send to blast |
MSSSNSPCAA CKFLRRKCTQ ECVFAPYFPP DQPQKFANVH KVFGASNVAK LLNELNATQR 60 EDAVNSLAYE AEYRLRDPVY GCVGLISVQ |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5ly0_A | 4e-46 | 3 | 88 | 7 | 92 | LOB family transfactor Ramosa2.1 |
| 5ly0_B | 4e-46 | 3 | 88 | 7 | 92 | LOB family transfactor Ramosa2.1 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Controls the proximal-distal patterning in petals and the adaxial-abaxial determination of leaves. Involved in the repression of the homeobox gene BP. {ECO:0000269|PubMed:12787254, ECO:0000269|PubMed:15821980}. | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_009774046.1 | 5e-60 | PREDICTED: LOB domain-containing protein 36-like | ||||
| Refseq | XP_016502483.1 | 5e-60 | PREDICTED: LOB domain-containing protein 36-like | ||||
| Refseq | XP_019234324.1 | 5e-60 | PREDICTED: LOB domain-containing protein 36-like isoform X2 | ||||
| Swissprot | Q9FKZ3 | 2e-52 | LBD36_ARATH; LOB domain-containing protein 36 | ||||
| TrEMBL | A0A1J6K9Q5 | 1e-58 | A0A1J6K9Q5_NICAT; Lob domain-containing protein 36 | ||||
| TrEMBL | A0A1S4CML7 | 1e-58 | A0A1S4CML7_TOBAC; LOB domain-containing protein 36-like | ||||
| TrEMBL | A0A1U7W9Z5 | 1e-58 | A0A1U7W9Z5_NICSY; LOB domain-containing protein 36-like | ||||
| STRING | XP_009774046.1 | 2e-59 | (Nicotiana sylvestris) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Asterids | OGEA43 | 24 | 669 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G66870.1 | 9e-55 | ASYMMETRIC LEAVES 2-like 1 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




