PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Niben101Scf03138g01021.1

Organism

Nicotiana benthamiana

Taxonomic ID

4100

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana

Family

MYB_related

Protein Properties

Length: 90aa MW: 10172.6 Da PI: 9.9622

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Niben101Scf03138g01021.1	genome	BTI	-

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	23.8	1e-07	29	61	15	47
HHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 15 avkqlGggtWktIartmgkgRtlkqcksrwqky 47 + +++G+g+W++I++ + +Rt+ q+ + qky Niben101Scf03138g01021.1 29 VLEKYGKGDWRSISSNVVVTRTPTQVATHAQKY 61 689*****************************9 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
TIGRFAMs	TIGR01557	6.5E-10	25	64	IPR006447	Myb domain, plants
SuperFamily	SSF46689	1.87E-9	25	66	IPR009057	Homeodomain-like
CDD	cd00167	5.52E-5	25	62	No hit	No description
Pfam	PF00249	1.9E-6	26	61	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	1.6E-5	29	59	IPR009057	Homeodomain-like

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 90 aa Download sequence Send to blast
MDEGGGQAIR TRPVLYPEII ADRWLFLIVL EKYGKGDWRS ISSNVVVTRT PTQVATHAQK 60 YFITQQAMKK EGKRSSIHDI TTAVDTNSHL

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription activator that coordinates abscisic acid (ABA) biosynthesis and signaling-related genes via binding to the specific promoter motif 5'-(A/T)AACCAT-3'. Represses ABA-mediated salt (e.g. NaCl and KCl) stress tolerance. Regulates leaf shape and promotes vegetative growth. {ECO:0000269\|PubMed:26243618}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Induced by salicylic acid (SA) and gibberellic acid (GA) (PubMed:16463103). Triggered by dehydration and salt stress (PubMed:26243618). {ECO:0000269\|PubMed:16463103, ECO:0000269\|PubMed:26243618}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_009592760.1	4e-33	PREDICTED: transcription factor DIVARICATA-like
Refseq	XP_009795456.1	4e-33	PREDICTED: transcription factor DIVARICATA-like
Refseq	XP_016443719.1	4e-33	PREDICTED: transcription factor DIVARICATA-like
Refseq	XP_016473251.1	4e-33	PREDICTED: transcription factor DIVARICATA-like
Swissprot	Q9FNN6	8e-24	SRM1_ARATH; Transcription factor SRM1
TrEMBL	A0A1S3XV16	9e-32	A0A1S3XV16_TOBAC; transcription factor DIVARICATA-like
TrEMBL	A0A1S4A9J2	8e-32	A0A1S4A9J2_TOBAC; transcription factor DIVARICATA-like
TrEMBL	A0A1U7Y0L8	8e-32	A0A1U7Y0L8_NICSY; transcription factor DIVARICATA-like
STRING	XP_009795456.1	1e-32	(Nicotiana sylvestris)
STRING	XP_009592760.1	1e-32	(Nicotiana tomentosiformis)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G04760.1	7e-29	MYB family protein

Publications ? help Back to Top
Wang T, et al. Salt-Related MYB1 Coordinates Abscisic Acid Biosynthesis and Signaling during Salt Stress in Arabidopsis. Plant Physiol., 2015. 169(2): p. 1027-41 [PMID:26243618] Chen YS, et al. Two MYB-related transcription factors play opposite roles in sugar signaling in Arabidopsis. Plant Mol. Biol., 2017. 93(3): p. 299-311 [PMID:27866313]