PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Niben101Scf03167g02028.1

Organism

Nicotiana benthamiana

Taxonomic ID

4100

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana

Family

YABBY

Protein Properties

Length: 184aa MW: 20432.1 Da PI: 7.5877

Description

YABBY family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Niben101Scf03167g02028.1	genome	BTI	-

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	YABBY	67.8	4.1e-21	13	58	2	47
YABBY 2 dvfssseqvCyvqCnfCntilavsvPstslfkvvtvrCGhCtslls 47 d+ seq+Cy +Cn C+t+lavsvP tslfk+vtvrCGhC++ll Niben101Scf03167g02028.1 13 DHLPPSEQLCYAHCNICDTVLAVSVPCTSLFKTVTVRCGHCSNLLP 58 577899**************************************95 PP
2	YABBY	123.2	3.8e-38	82	148	103	170
YABBY 103 enedeevprvppvirPPekrqrvPsaynrfikeeiqrikasnPdishreafsaaaknWahfPkihfgl 170 e+ + +p+ +++ PekrqrvPsaynrfikeeiqrika+nPdishreafsaaaknWahfP+i fgl Niben101Scf03167g02028.1 82 EEITSTTPN-FLMNQTPEKRQRVPSAYNRFIKEEIQRIKAGNPDISHREAFSAAAKNWAHFPHIQFGL 148 444444443.4479****************************************************97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Pfam	PF04690	2.5E-19	17	57	IPR006780	YABBY protein
Pfam	PF04690	8.9E-37	87	148	IPR006780	YABBY protein
SuperFamily	SSF47095	6.02E-8	93	142	IPR009071	High mobility group box domain
Gene3D	G3DSA:1.10.30.10	4.3E-5	96	142	IPR009071	High mobility group box domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0007275	Biological Process	multicellular organism development

Sequence ? help Back to Top
Protein Sequence Length: 184 aa Download sequence Send to blast
MSSSTPNSTL SLDHLPPSEQ LCYAHCNICD TVLAVSVPCT SLFKTVTVRC GHCSNLLPGL 60 LLPSANHHFG HTYFSPAHNL LEEITSTTPN FLMNQTPEKR QRVPSAYNRF IKEEIQRIKA 120 GNPDISHREA FSAAAKNWAH FPHIQFGLMP DQTAKRANVR QQDGEDVLMK DGLFNSANVS 180 VSPY

Functional Description ? help Back to Top
Source	Description
UniProt	Involved in the abaxial cell fate determination during embryogenesis and organogenesis. Regulates the initiation of embryonic shoot apical meristem (SAM) development (PubMed:10323860, PubMed:10331982, PubMed:10457020, PubMed:11812777, PubMed:12417699, PubMed:9878633, Ref.3, Ref.6, PubMed:19837869). Required during flower formation and development, particularly for the patterning of floral organs. Positive regulator of class B (AP3 and PI) activity in whorls 2 and 3. Negative regulator of class B activity in whorl 1 and of SUP activity in whorl 3. Interacts with class A proteins (AP1, AP2 and LUG) to repress class C (AG) activity in whorls 1 and 2. Contributes to the repression of KNOX genes (STM, KNAT1/BP and KNAT2) to avoid ectopic meristems. Binds DNA without sequence specificity. In vitro, can compete and displace the AP1 protein binding to DNA containing CArG box (PubMed:10323860, PubMed:10331982, PubMed:10457020, PubMed:11812777, PubMed:12417699, PubMed:9878633, Ref.3, Ref.6). {ECO:0000269\|PubMed:10323860, ECO:0000269\|PubMed:10331982, ECO:0000269\|PubMed:10457020, ECO:0000269\|PubMed:11812777, ECO:0000269\|PubMed:12417699, ECO:0000269\|PubMed:19837869, ECO:0000269\|PubMed:9878633, ECO:0000269\|Ref.3, ECO:0000269\|Ref.6}.
UniProt	Involved in the abaxial cell fate determination during embryogenesis and organogenesis. Regulates the initiation of embryonic shoot apical meristem (SAM) development (PubMed:10457020, PubMed:12417699, PubMed:19837869). Contributes to the repression of KNOX genes (STM, KNAT1/BP and KNAT2) to avoid ectopic meristems. Binds DNA without sequence specificity (PubMed:10457020, PubMed:12417699). {ECO:0000269\|PubMed:10457020, ECO:0000269\|PubMed:12417699, ECO:0000269\|PubMed:19837869}.
UniProt	May be involved in leaf cell growth and differentiation, rather than abaxial cell fate determination. {ECO:0000250}.
UniProt	May be involved in leaf cell growth and differentiation, rather than abaxial cell fate determination. {ECO:0000269\|PubMed:17351053}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Repressed by WOX3. {ECO:0000269\|PubMed:17351053}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_019244930.1	1e-126	PREDICTED: protein YABBY 4-like
Swissprot	O22152	3e-67	YAB1_ARATH; Axial regulator YABBY 1
Swissprot	Q01JG2	5e-67	YAB5_ORYSI; Protein YABBY 5
Swissprot	Q0JBF0	5e-67	YAB5_ORYSJ; Protein YABBY 5
Swissprot	Q9XFB1	3e-67	YAB3_ARATH; Axial regulator YABBY 3
TrEMBL	A0A1J6J266	1e-124	A0A1J6J266_NICAT; Protein yabby 4
STRING	XP_009781194.1	1e-123	(Nicotiana sylvestris)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA381	24	163

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G45190.1	1e-69	YABBY family protein

Publications ? help Back to Top
Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764] Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Yadav RK, et al. Plant stem cell maintenance involves direct transcriptional repression of differentiation program. Mol. Syst. Biol., 2013. 9: p. 654 [PMID:23549482] Lian H,Li X,Liu Z,He Y HYL1 is required for establishment of stamen architecture with four microsporangia in Arabidopsis. J. Exp. Bot., 2013. 64(11): p. 3397-410 [PMID:23918970] Tameshige T, et al. Pattern dynamics in adaxial-abaxial specific gene expression are modulated by a plastid retrograde signal during Arabidopsis thaliana leaf development. PLoS Genet., 2013. 9(7): p. e1003655 [PMID:23935517] Boter M, et al. FILAMENTOUS FLOWER Is a Direct Target of JAZ3 and Modulates Responses to Jasmonate. Plant Cell, 2015. 27(11): p. 3160-74 [PMID:26530088] Khanday I, et al. Genome-Wide Targets Regulated by the OsMADS1 Transcription Factor Reveals Its DNA Recognition Properties. Plant Physiol., 2016. 172(1): p. 372-88 [PMID:27457124] Douglas SJ,Li B,Kliebenstein DJ,Nambara E,Riggs CD A novel Filamentous Flower mutant suppresses brevipedicellus developmental defects and modulates glucosinolate and auxin levels. PLoS ONE, 2017. 12(5): p. e0177045 [PMID:28493925] Tanaka W,Toriba T,Hirano HY Three TOB1-related YABBY genes are required to maintain proper function of the spikelet and branch meristems in rice. New Phytol., 2017. 215(2): p. 825-839 [PMID:28556940] Silverblatt-Buser EW,Frick MA,Rabeler C,Kaplinsky NJ Genetic Interactions Between BOB1 and Multiple 26S Proteasome Subunits Suggest a Role for Proteostasis in Regulating Arabidopsis Development. G3 (Bethesda), 2018. 8(4): p. 1379-1390 [PMID:29487187]