![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Niben101Scf04514g03005.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
|
||||||||
| Family | Whirly | ||||||||
| Protein Properties | Length: 119aa MW: 13918.9 Da PI: 4.9477 | ||||||||
| Description | Whirly family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Whirly | 132.1 | 2.9e-41 | 1 | 104 | 35 | 138 |
Whirly 35 llelanataerkydWekkqsfalsatevaelvdlaskesceffhdpaakgsneGkvrkalkvePlpdGsGlfvnlsvtnslvkgn 119
+l++a+a+++r+ydW++ q+f+l + e++++++l+ k+sceffh p +++++eGkvrk+l+ve lpdGsG f+nlsv+n+l++ +
Niben101Scf04514g03005.1 1 MLQFAPAAGVRQYDWGRMQVFSLFVIEMGSFINLGEKDSCEFFHYPNKEKGDEGKVRKVLRVELLPDGSGRFFNLSVQNKLINLD 85
89*********************************************************************************** PP
Whirly 120 esfsvPvskaefavlrsll 138
e++++P ++ efavl ++
Niben101Scf04514g03005.1 86 ENIYIPATEEEFAVLVFAF 104
***************9887 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Pfam | PF08536 | 1.9E-36 | 1 | 100 | IPR013742 | Plant transcription factor |
| SuperFamily | SSF54447 | 7.85E-36 | 1 | 106 | IPR009044 | ssDNA-binding transcriptional regulator |
| Gene3D | G3DSA:2.30.31.10 | 1.2E-36 | 1 | 105 | IPR009044 | ssDNA-binding transcriptional regulator |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 119 aa Download sequence Send to blast |
MLQFAPAAGV RQYDWGRMQV FSLFVIEMGS FINLGEKDSC EFFHYPNKEK GDEGKVRKVL 60 RVELLPDGSG RFFNLSVQNK LINLDENIYI PATEEEFAVL VFAFNRIEVW SPCRRERDY |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1l3a_A | 3e-56 | 1 | 105 | 77 | 181 | p24: plant transcriptional regulator PBF-2 |
| 1l3a_B | 3e-56 | 1 | 105 | 77 | 181 | p24: plant transcriptional regulator PBF-2 |
| 1l3a_C | 3e-56 | 1 | 105 | 77 | 181 | p24: plant transcriptional regulator PBF-2 |
| 1l3a_D | 3e-56 | 1 | 105 | 77 | 181 | p24: plant transcriptional regulator PBF-2 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Single-stranded DNA-binding protein that acts as a transcriptional activator of the pathogenesis-related gene PR-10a. Upon elicitation, binds a 30bp promoter sequence known as elicitor element response (ERE) and is required for PR-10a expression. {ECO:0000269|PubMed:10948264, ECO:0000269|PubMed:12080340, ECO:0000269|PubMed:14960277}. | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_016474450.1 | 9e-57 | PREDICTED: single-stranded DNA-binding protein WHY1, chloroplastic-like | ||||
| Refseq | XP_019257017.1 | 1e-56 | PREDICTED: single-stranded DNA-binding protein WHY1, chloroplastic-like | ||||
| Swissprot | Q9LL85 | 4e-56 | WHY1_SOLTU; Single-stranded DNA-binding protein WHY1, chloroplastic | ||||
| TrEMBL | A0A1J6IDX2 | 3e-55 | A0A1J6IDX2_NICAT; Single-stranded dna-binding protein why1, chloroplastic | ||||
| TrEMBL | A0A1S4ACQ8 | 2e-55 | A0A1S4ACQ8_TOBAC; single-stranded DNA-binding protein WHY1, chloroplastic-like | ||||
| STRING | XP_009758353.1 | 2e-55 | (Nicotiana sylvestris) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Asterids | OGEA7731 | 24 | 30 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G02740.2 | 1e-54 | ssDNA-binding transcriptional regulator | ||||




