PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Niben101Scf05519g00002.1

Organism

Nicotiana benthamiana

Taxonomic ID

4100

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana

Family

bZIP

Protein Properties

Length: 130aa MW: 14584.6 Da PI: 10.2737

Description

bZIP family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Niben101Scf05519g00002.1	genome	BTI	-

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	bZIP_1	50.4	4.8e-16	81	125	4	48
XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkke 48 ++r rrk+kNRe+A rsR+RK+a++ eL +kv Le+eN++Lkke Niben101Scf05519g00002.1 81 DRRLRRKIKNRESAARSRARKQAYQNELVTKVSLLEEENMKLKKE 125 789****************************************98 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00338	2.8E-7	78	129	IPR004827	Basic-leucine zipper domain
PROSITE profile	PS50217	10.76	80	125	IPR004827	Basic-leucine zipper domain
Pfam	PF00170	2.5E-14	81	125	IPR004827	Basic-leucine zipper domain
SuperFamily	SSF57959	6.25E-11	82	125	No hit	No description
CDD	cd14707	5.58E-17	82	127	No hit	No description
Gene3D	G3DSA:1.20.5.170	2.0E-12	82	125	No hit	No description
PROSITE pattern	PS00036	0	85	100	IPR004827	Basic-leucine zipper domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 130 aa Download sequence Send to blast
MNDQERKPTL GETTLEDYLV KAGLFSADAS LGHTMSLDNP TAVQNFVPPI GLSPSPSIDA 60 LSDTPFSGRK RDATDIDKTL DRRLRRKIKN RESAARSRAR KQAYQNELVT KVSLLEEENM 120 KLKKEKIGVR

Functional Description ? help Back to Top
Source	Description
UniProt	Binds to the embryo specification element and the ABA-responsive element (ABRE) of the Dc3 gene promoter and to the ABRE of the Em1 gene promoter. Could participate in abscisic acid-regulated gene expression during seed development.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_019258990.1	1e-75	PREDICTED: LOW QUALITY PROTEIN: ABSCISIC ACID-INSENSITIVE 5-like protein 2, partial
Swissprot	Q9C5Q2	3e-24	AI5L3_ARATH; ABSCISIC ACID-INSENSITIVE 5-like protein 3
TrEMBL	A0A314LG83	8e-75	A0A314LG83_NICAT; Abscisic acid-insensitive 5-like protein 2
STRING	XP_009588379.1	8e-78	(Nicotiana tomentosiformis)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA12596	16	19

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G41070.3	3e-22	bZIP family protein

Publications ? help Back to Top
Haas BJ, et al. Full-length messenger RNA sequences greatly improve genome annotation. Genome Biol., 2002. 3(6): p. RESEARCH0029 [PMID:12093376] Sakuraba Y,Han SH,Lee SH,Hörtensteiner S,Paek NC Arabidopsis NAC016 promotes chlorophyll breakdown by directly upregulating STAYGREEN1 transcription. Plant Cell Rep., 2016. 35(1): p. 155-66 [PMID:26441053] Kim H, et al. ABA-HYPERSENSITIVE BTB/POZ PROTEIN 1 functions as a negative regulator in ABA-mediated inhibition of germination in Arabidopsis. Plant Mol. Biol., 2016. 90(3): p. 303-15 [PMID:26667153]