![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Niben101Scf05618g05010.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
|
||||||||
| Family | M-type_MADS | ||||||||
| Protein Properties | Length: 76aa MW: 8708.31 Da PI: 10.3907 | ||||||||
| Description | M-type_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 101.1 | 4.1e-32 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
krienk+nrqvtf+kRrng+lKKA+ELSvLC+aeva+iifs++gklye++s
Niben101Scf05618g05010.1 9 KRIENKINRQVTFAKRRNGLLKKAYELSVLCEAEVALIIFSNRGKLYEFCS 59
79***********************************************96 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50066 | 33.067 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
| SMART | SM00432 | 2.0E-40 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
| SuperFamily | SSF55455 | 1.96E-30 | 2 | 61 | IPR002100 | Transcription factor, MADS-box |
| CDD | cd00265 | 1.95E-38 | 2 | 65 | No hit | No description |
| PRINTS | PR00404 | 4.4E-33 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
| PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 1.3E-26 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 4.4E-33 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 4.4E-33 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 76 aa Download sequence Send to blast |
MGRGRVELKR IENKINRQVT FAKRRNGLLK KAYELSVLCE AEVALIIFSN RGKLYEFCSS 60 NNSIVCVFLG PCPMQR |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 6byy_A | 9e-20 | 1 | 61 | 1 | 61 | MEF2 CHIMERA |
| 6byy_B | 9e-20 | 1 | 61 | 1 | 61 | MEF2 CHIMERA |
| 6byy_C | 9e-20 | 1 | 61 | 1 | 61 | MEF2 CHIMERA |
| 6byy_D | 9e-20 | 1 | 61 | 1 | 61 | MEF2 CHIMERA |
| 6bz1_A | 9e-20 | 1 | 61 | 1 | 61 | MEF2 CHIMERA |
| 6bz1_B | 9e-20 | 1 | 61 | 1 | 61 | MEF2 CHIMERA |
| 6bz1_C | 9e-20 | 1 | 61 | 1 | 61 | MEF2 CHIMERA |
| 6bz1_D | 9e-20 | 1 | 61 | 1 | 61 | MEF2 CHIMERA |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor. Functions with SEPALLATA2/AGL4 and SEPALLATA3/AGL9 to ensure proper development of petals, stamens and carpels, and to prevent the indeterminate growth of the flower meristem. Forms a heterodimer via the K-box domain with AGAMOUS, that could be involved in genes regulation during floral meristem development. | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_019227024.1 | 1e-36 | PREDICTED: developmental protein SEPALLATA 1-like isoform X2 | ||||
| Refseq | XP_019227025.1 | 1e-36 | PREDICTED: developmental protein SEPALLATA 1-like isoform X3 | ||||
| Swissprot | P29382 | 1e-35 | SEP1_ARATH; Developmental protein SEPALLATA 1 | ||||
| TrEMBL | A0A103XKV5 | 5e-36 | A0A103XKV5_CYNCS; Transcription factor, K-box | ||||
| STRING | cassava4.1_033922m | 2e-35 | (Manihot esculenta) | ||||
| STRING | XP_009757151.1 | 2e-35 | (Nicotiana sylvestris) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Asterids | OGEA40 | 24 | 625 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G15800.1 | 5e-38 | MIKC_MADS family protein | ||||




