PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Niben101Scf05620g02002.1

Organism

Nicotiana benthamiana

Taxonomic ID

4100

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana

Family

M-type_MADS

Protein Properties

Length: 111aa MW: 12756.2 Da PI: 10.4641

Description

M-type_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Niben101Scf05620g02002.1	genome	BTI	-

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	99.9	9.9e-32	9	59	1	51
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krienk++rqvtf+kRrng+lKKA+ELSvLCdaeva+iifs++gklye++s Niben101Scf05620g02002.1 9 KRIENKIKRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCS 59 79***********************************************96 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00432	1.4E-40	1	60	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS50066	33.123	1	61	IPR002100	Transcription factor, MADS-box
CDD	cd00265	2.95E-39	2	70	No hit	No description
SuperFamily	SSF55455	6.8E-31	2	66	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.3E-32	3	23	IPR002100	Transcription factor, MADS-box
PROSITE pattern	PS00350	0	3	57	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	7.8E-27	10	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.3E-32	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.3E-32	38	59	IPR002100	Transcription factor, MADS-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 111 aa Download sequence Send to blast
MGRGRVELKR IENKIKRQVT FAKRRNGLLK KAYELSVLCD AEVALIIFSN RGKLYEFCSS 60 SSHRPMIILR LPCLMKKKQS KYYALGFTFN IMLYSLDELG SPLELLPSLP A

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1tqe_P	6e-19	1	67	1	67	Myocyte-specific enhancer factor 2B
1tqe_Q	6e-19	1	67	1	67	Myocyte-specific enhancer factor 2B
1tqe_R	6e-19	1	67	1	67	Myocyte-specific enhancer factor 2B
1tqe_S	6e-19	1	67	1	67	Myocyte-specific enhancer factor 2B
6c9l_A	6e-19	1	67	1	67	Myocyte-specific enhancer factor 2B
6c9l_B	6e-19	1	67	1	67	Myocyte-specific enhancer factor 2B
6c9l_C	6e-19	1	67	1	67	Myocyte-specific enhancer factor 2B
6c9l_D	6e-19	1	67	1	67	Myocyte-specific enhancer factor 2B
6c9l_E	6e-19	1	67	1	67	Myocyte-specific enhancer factor 2B
6c9l_F	6e-19	1	67	1	67	Myocyte-specific enhancer factor 2B
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_007158665.1	3e-36	hypothetical protein PHAVU_002G1723001g, partial
Refseq	XP_007158666.1	4e-36	hypothetical protein PHAVU_002G1723001g, partial
Refseq	XP_009622386.1	2e-36	PREDICTED: MADS-box protein CMB1-like
Refseq	XP_016438828.1	2e-36	PREDICTED: MADS-box protein CMB1-like
Refseq	XP_020706092.1	3e-36	agamous-like MADS-box protein AGL9 homolog
Swissprot	Q03489	3e-36	AGL9_PETHY; Agamous-like MADS-box protein AGL9 homolog
TrEMBL	A0A1S3XG51	4e-35	A0A1S3XG51_TOBAC; MADS-box protein CMB1-like
TrEMBL	A0A438DXH4	2e-35	A0A438DXH4_VITVI; Agamous-like MADS-box protein AGL9-like
STRING	XP_007158666.1	1e-35	(Phaseolus vulgaris)
STRING	cassava4.1_033924m	4e-36	(Manihot esculenta)
STRING	XP_009622386.1	1e-35	(Nicotiana tomentosiformis)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA40	24	625

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G24260.3	2e-38	MIKC_MADS family protein

Publications ? help Back to Top
Immink RG,Gadella TW,Ferrario S,Busscher M,Angenent GC Analysis of MADS box protein-protein interactions in living plant cells. Proc. Natl. Acad. Sci. U.S.A., 2002. 99(4): p. 2416-21 [PMID:11854533] Immink RG, et al. Analysis of the petunia MADS-box transcription factor family. Mol. Genet. Genomics, 2003. 268(5): p. 598-606 [PMID:12589434] Angenent GC,Busscher M,Franken J,Mol JN,van Tunen AJ Differential expression of two MADS box genes in wild-type and mutant petunia flowers. Plant Cell, 1992. 4(8): p. 983-93 [PMID:1356537] Tonaco IA,Borst JW,de Vries SC,Angenent GC,Immink RG In vivo imaging of MADS-box transcription factor interactions. J. Exp. Bot., 2006. 57(1): p. 33-42 [PMID:16291798]