PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Niben101Scf06076g00010.1

Organism

Nicotiana benthamiana

Taxonomic ID

4100

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana

Family

M-type_MADS

Protein Properties

Length: 109aa MW: 12516.4 Da PI: 10.0079

Description

M-type_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Niben101Scf06076g00010.1	genome	BTI	-

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	89	2.4e-28	9	59	1	51
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krienk+ rqvtfskRr g+lKK +E+S+LCda+va+i+fs +gkl+eys+ Niben101Scf06076g00010.1 9 KRIENKISRQVTFSKRRSGLLKKTHEISILCDADVALIVFSAKGKLFEYST 59 79***********************************************96 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50066	31.076	1	61	IPR002100	Transcription factor, MADS-box
SMART	SM00432	1.5E-37	1	60	IPR002100	Transcription factor, MADS-box
SuperFamily	SSF55455	5.1E-33	2	87	IPR002100	Transcription factor, MADS-box
CDD	cd00265	5.33E-40	2	76	No hit	No description
PRINTS	PR00404	6.0E-30	3	23	IPR002100	Transcription factor, MADS-box
PROSITE pattern	PS00350	0	3	57	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	9.8E-25	10	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	6.0E-30	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	6.0E-30	38	59	IPR002100	Transcription factor, MADS-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 109 aa Download sequence Send to blast
MGRGRVEMKR IENKISRQVT FSKRRSGLLK KTHEISILCD ADVALIVFSA KGKLFEYSTE 60 SSMESILERY ESYSYAERKL NANDSEPKVF HISFISSSPM VTRQHIPPT

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
6byy_A	2e-20	1	74	1	73	MEF2 CHIMERA
6byy_B	2e-20	1	74	1	73	MEF2 CHIMERA
6byy_C	2e-20	1	74	1	73	MEF2 CHIMERA
6byy_D	2e-20	1	74	1	73	MEF2 CHIMERA
6bz1_A	2e-20	1	74	1	73	MEF2 CHIMERA
6bz1_B	2e-20	1	74	1	73	MEF2 CHIMERA
6bz1_C	2e-20	1	74	1	73	MEF2 CHIMERA
6bz1_D	2e-20	1	74	1	73	MEF2 CHIMERA
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor that promotes early floral meristem identity in synergy with APETALA1, FRUITFULL and LEAFY. Is required subsequently for the transition of an inflorescence meristem into a floral meristem. Seems to be partially redundant to the function of APETALA1. {ECO:0000269\|PubMed:10765981}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_019263716.1	2e-56	PREDICTED: truncated transcription factor CAULIFLOWER A-like
Refseq	XP_019263717.1	2e-56	PREDICTED: truncated transcription factor CAULIFLOWER A-like
Swissprot	Q6R4R9	8e-46	CALA_BRAOB; Truncated transcription factor CAULIFLOWER A
TrEMBL	A0A314L5X3	5e-55	A0A314L5X3_NICAT; Agamous-like mads-box protein agl8
STRING	XP_009616788.1	7e-55	(Nicotiana tomentosiformis)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA499	23	97

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G69120.1	1e-45	MIKC_MADS family protein

Publications ? help Back to Top
Li XF,Shen RJ,Liu PL,Tang ZC,He YK Molecular characters and morphological genetics of CAL gene in Chinese cabbage. Cell Res., 2000. 10(1): p. 29-38 [PMID:10765981]