PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Niben101Scf06517g00007.1

Organism

Nicotiana benthamiana

Taxonomic ID

4100

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana

Family

M-type_MADS

Protein Properties

Length: 63aa MW: 7083.26 Da PI: 11.081

Description

M-type_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Niben101Scf06517g00007.1	genome	BTI	-

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	95.2	2.9e-30	10	59	2	51
---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 ri+n++ rqvtfskRrng+lKKA+EL +LCdaev viifsstgklyeyss Niben101Scf06517g00007.1 10 RIDNSTSRQVTFSKRRNGLLKKAKELAILCDAEVGVIIFSSTGKLYEYSS 59 8***********************************************96 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50066	31.959	1	61	IPR002100	Transcription factor, MADS-box
SMART	SM00432	2.7E-40	1	60	IPR002100	Transcription factor, MADS-box
SuperFamily	SSF55455	4.32E-29	2	60	IPR002100	Transcription factor, MADS-box
CDD	cd00265	2.37E-36	2	60	No hit	No description
PRINTS	PR00404	6.6E-30	3	23	IPR002100	Transcription factor, MADS-box
PROSITE pattern	PS00350	0	3	57	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	3.7E-27	10	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	6.6E-30	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	6.6E-30	38	59	IPR002100	Transcription factor, MADS-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 63 aa Download sequence Send to blast
MGRGKIMIRR IDNSTSRQVT FSKRRNGLLK KAKELAILCD AEVGVIIFSS TGKLYEYSST 60 RST

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
5f28_A	1e-20	1	60	1	60	MEF2C
5f28_B	1e-20	1	60	1	60	MEF2C
5f28_C	1e-20	1	60	1	60	MEF2C
5f28_D	1e-20	1	60	1	60	MEF2C
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcriptional factor that targets the CArG motif 5'-C(A/T)TTAAAAAG-3' in the promoter of D14. Directly suppresses D14 expression to control the outgrowth of axillary buds. {ECO:0000269\|PubMed:23463009}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_018631477.1	4e-35	PREDICTED: MADS-box transcription factor 27-like isoform X4
Swissprot	Q6Z6W2	4e-33	MAD57_ORYSJ; MADS-box transcription factor 57
TrEMBL	A0A438F857	1e-34	A0A438F857_VITVI; MADS-box transcription factor ANR1
TrEMBL	A0A438G0F5	1e-34	A0A438G0F5_VITVI; MADS-box transcription factor ANR1
STRING	Lus10028214	9e-35	(Linum usitatissimum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA40	24	625

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G14210.1	3e-35	AGAMOUS-like 44

Publications ? help Back to Top
Guo S, et al. The interaction between OsMADS57 and OsTB1 modulates rice tillering via DWARF14. Nat Commun, 2013. 4: p. 1566 [PMID:23463009] Puig J, et al. Analysis of the expression of the AGL17-like clade of MADS-box transcription factors in rice. Gene Expr. Patterns, 2013 Jun-Jul. 13(5-6): p. 160-70 [PMID:23466806] Yu C, et al. The effects of fluctuations in the nutrient supply on the expression of five members of the AGL17 clade of MADS-box genes in rice. PLoS ONE, 2014. 9(8): p. e105597 [PMID:25140876] Wang H, et al. A Signaling Cascade from miR444 to RDR1 in Rice Antiviral RNA Silencing Pathway. Plant Physiol., 2016. 170(4): p. 2365-77 [PMID:26858364]